diff --git a/CHANGELOG.md b/CHANGELOG.md
index 75bb2021..39bc4205 100644
--- a/CHANGELOG.md
+++ b/CHANGELOG.md
@@ -7,10 +7,12 @@ and this project adheres to [Semantic Versioning](https://semver.org/spec/v2.0.0
### `Changed`
+- [#111](https://github.com/nf-core/bacass/pull/111) - Update nf-core/bacass to 2.12, and [#117](https://github.com/nf-core/bacass/pull/117) to 2.13.1 `TEMPLATE`.
+- [#120](https://github.com/nf-core/bacass/pull/120) - Update local and nf-core modules (version update an minnor code changes).
+
### `Added`
- [#104](https://github.com/nf-core/bacass/pull/104), [#106](https://github.com/nf-core/bacass/pull/106) - Added dragonflye module and enbled draft genome polishing with short-reads.
-- [#111](https://github.com/nf-core/bacass/pull/111) - Update nf-core/bacass to 2.12, and [#117](https://github.com/nf-core/bacass/pull/117) to 2.13.1 `TEMPLATE`.
### `Fixed`
diff --git a/modules.json b/modules.json
index d52cac22..1a559c15 100644
--- a/modules.json
+++ b/modules.json
@@ -7,12 +7,12 @@
"nf-core": {
"bakta/bakta": {
"branch": "master",
- "git_sha": "f05fa7c6753f92be861d606378860dcd5c828880",
+ "git_sha": "9d0f89b445e1f5b2fb30476f4be9a8b519c07846",
"installed_by": ["modules"]
},
"bakta/baktadbdownload": {
"branch": "master",
- "git_sha": "516189e968feb4ebdd9921806988b4c12b4ac2dc",
+ "git_sha": "7c06e6820fa3918bc28a040e794f8a2b39fabadb",
"installed_by": ["modules"]
},
"canu": {
@@ -22,13 +22,13 @@
},
"dragonflye": {
"branch": "master",
- "git_sha": "516189e968feb4ebdd9921806988b4c12b4ac2dc",
+ "git_sha": "a3ae45e99f68e513b0feb8d5f27e2fdd0d0f083d",
"installed_by": ["modules"],
"patch": "modules/nf-core/dragonflye/dragonflye.diff"
},
"fastp": {
"branch": "master",
- "git_sha": "003920c7f9a8ae19b69a97171922880220bedf56",
+ "git_sha": "95cf5fe0194c7bf5cb0e3027a2eb7e7c89385080",
"installed_by": ["fastq_trim_fastp_fastqc"]
},
"fastqc": {
@@ -38,22 +38,22 @@
},
"gunzip": {
"branch": "master",
- "git_sha": "e06548bfa36ee31869b81041879dd6b3a83b1d57",
+ "git_sha": "3a5fef109d113b4997c9822198664ca5f2716208",
"installed_by": ["modules"]
},
"kraken2/kraken2": {
"branch": "master",
- "git_sha": "603ecbd9f45300c9788f197d2a15a005685b4220",
+ "git_sha": "653218e79ffa76fde20319e9062f8b8da5cf7555",
"installed_by": ["modules"]
},
"miniasm": {
"branch": "master",
- "git_sha": "911696ea0b62df80e900ef244d7867d177971f73",
+ "git_sha": "3f5420aa22e00bd030a2556dfdffc9e164ec0ec5",
"installed_by": ["modules"]
},
"minimap2/align": {
"branch": "master",
- "git_sha": "603ecbd9f45300c9788f197d2a15a005685b4220",
+ "git_sha": "2c2d1cf80866dbd6dd0ea5d61ddd59533a72d41e",
"installed_by": ["modules"]
},
"multiqc": {
@@ -63,43 +63,43 @@
},
"nanoplot": {
"branch": "master",
- "git_sha": "3f5420aa22e00bd030a2556dfdffc9e164ec0ec5",
+ "git_sha": "a31407dfaf0cb0d04768d5cb439fc6f4523a6981",
"installed_by": ["modules"],
"patch": "modules/nf-core/nanoplot/nanoplot.diff"
},
"porechop/porechop": {
"branch": "master",
- "git_sha": "911696ea0b62df80e900ef244d7867d177971f73",
+ "git_sha": "1d68c7f248d1a480c5959548a9234602b771199e",
"installed_by": ["modules"]
},
"prokka": {
"branch": "master",
- "git_sha": "911696ea0b62df80e900ef244d7867d177971f73",
+ "git_sha": "49ebda931c36c2b282f7958d00e1236b751f1031",
"installed_by": ["modules"]
},
"quast": {
"branch": "master",
- "git_sha": "344638191a5d6b3526556410819dfcf24e98039e",
+ "git_sha": "3f5420aa22e00bd030a2556dfdffc9e164ec0ec5",
"installed_by": ["modules"]
},
"racon": {
"branch": "master",
- "git_sha": "911696ea0b62df80e900ef244d7867d177971f73",
+ "git_sha": "3f5420aa22e00bd030a2556dfdffc9e164ec0ec5",
"installed_by": ["modules"]
},
"samtools/index": {
"branch": "master",
- "git_sha": "911696ea0b62df80e900ef244d7867d177971f73",
+ "git_sha": "f4596fe0bdc096cf53ec4497e83defdb3a94ff62",
"installed_by": ["modules"]
},
"samtools/sort": {
"branch": "master",
- "git_sha": "a0f7be95788366c1923171e358da7d049eb440f9",
+ "git_sha": "4352dbdb09ec40db71e9b172b97a01dcf5622c26",
"installed_by": ["modules"]
},
"untar": {
"branch": "master",
- "git_sha": "d0b4fc03af52a1cc8c6fb4493b921b57352b1dd8",
+ "git_sha": "5caf7640a9ef1d18d765d55339be751bb0969dfa",
"installed_by": ["modules"]
}
}
diff --git a/modules/local/dfast/environment.yml b/modules/local/dfast/environment.yml
new file mode 100644
index 00000000..f5542598
--- /dev/null
+++ b/modules/local/dfast/environment.yml
@@ -0,0 +1,7 @@
+name: dfast
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::dfast=1.2.20
diff --git a/modules/local/dfast.nf b/modules/local/dfast/main.nf
similarity index 96%
rename from modules/local/dfast.nf
rename to modules/local/dfast/main.nf
index db7be3da..3d82b660 100644
--- a/modules/local/dfast.nf
+++ b/modules/local/dfast/main.nf
@@ -2,7 +2,7 @@ process DFAST {
tag "$meta.id"
label 'process_medium'
- conda "bioconda::dfast=1.2.20"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/dfast:1.2.20--h43eeafb_0' :
'biocontainers/dfast:1.2.20--h43eeafb_0' }"
diff --git a/modules/local/kraken2_db_preparation/environment.yml b/modules/local/kraken2_db_preparation/environment.yml
new file mode 100644
index 00000000..01258158
--- /dev/null
+++ b/modules/local/kraken2_db_preparation/environment.yml
@@ -0,0 +1,7 @@
+name: kraken2_db_preparation
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - conda-forge::sed=4.7
diff --git a/modules/local/kraken2_db_preparation.nf b/modules/local/kraken2_db_preparation/main.nf
similarity index 56%
rename from modules/local/kraken2_db_preparation.nf
rename to modules/local/kraken2_db_preparation/main.nf
index d2af01b6..110383e6 100644
--- a/modules/local/kraken2_db_preparation.nf
+++ b/modules/local/kraken2_db_preparation/main.nf
@@ -2,16 +2,17 @@ process KRAKEN2_DB_PREPARATION {
tag "${db.simpleName}"
label 'process_low'
- conda 'conda-forge::sed=4.7'
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
- 'https://containers.biocontainers.pro/s3/SingImgsRepo/biocontainers/v1.2.0_cv1/biocontainers_v1.2.0_cv1.img' :
- 'docker.io/biocontainers/biocontainers:v1.2.0_cv1' }"
+ 'https://depot.galaxyproject.org/singularity/ubuntu:20.04' :
+ 'nf-core/ubuntu:20.04' }"
input:
path db
output:
tuple val("${db.simpleName}"), path("database"), emit: db
+ path "versions.yml" , emit: versions
when:
task.ext.when == null || task.ext.when
@@ -22,5 +23,10 @@ process KRAKEN2_DB_PREPARATION {
tar -xf "${db}" -C db_tmp
mkdir database
mv `find db_tmp/ -name "*.k2d"` database/
+
+ cat <<-END_VERSIONS > versions.yml
+ "${task.process}":
+ tar: \$(tar --version | sed -n 's/^tar (GNU tar) \$([0-9.]*\$).*/\$1/p')
+ END_VERSIONS
"""
}
diff --git a/modules/local/medaka/environment.yml b/modules/local/medaka/environment.yml
new file mode 100644
index 00000000..4b9b96bd
--- /dev/null
+++ b/modules/local/medaka/environment.yml
@@ -0,0 +1,7 @@
+name: medaka
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - medaka=1.4.3-0
diff --git a/modules/local/medaka.nf b/modules/local/medaka/main.nf
similarity index 97%
rename from modules/local/medaka.nf
rename to modules/local/medaka/main.nf
index e57666a8..7cc540be 100644
--- a/modules/local/medaka.nf
+++ b/modules/local/medaka/main.nf
@@ -2,7 +2,7 @@ process MEDAKA {
tag "$meta.id"
label 'process_high'
- conda 'medaka=1.4.3-0'
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/medaka:1.4.3--py38h130def0_0' :
'biocontainers/medaka:1.4.3--py38h130def0_0' }"
diff --git a/modules/local/nanopolish/environment.yml b/modules/local/nanopolish/environment.yml
new file mode 100644
index 00000000..ef8827ae
--- /dev/null
+++ b/modules/local/nanopolish/environment.yml
@@ -0,0 +1,7 @@
+name: nanopolish
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::nanopolish=0.14.0
diff --git a/modules/local/nanopolish.nf b/modules/local/nanopolish/main.nf
similarity index 96%
rename from modules/local/nanopolish.nf
rename to modules/local/nanopolish/main.nf
index 34ca78d3..59f4f166 100644
--- a/modules/local/nanopolish.nf
+++ b/modules/local/nanopolish/main.nf
@@ -2,7 +2,7 @@ process NANOPOLISH {
tag "$meta.id"
label 'process_high'
- conda "bioconda::nanopolish=0.14.0"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/nanopolish:0.14.0--h773013f_3' :
'biocontainers/nanopolish:0.14.0--h773013f_3' }"
diff --git a/modules/local/pycoqc/environment.yml b/modules/local/pycoqc/environment.yml
new file mode 100644
index 00000000..c2a3a4d1
--- /dev/null
+++ b/modules/local/pycoqc/environment.yml
@@ -0,0 +1,7 @@
+name: pycoqc
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::pycoqc=2.5.2
diff --git a/modules/local/pycoqc.nf b/modules/local/pycoqc/main.nf
similarity index 97%
rename from modules/local/pycoqc.nf
rename to modules/local/pycoqc/main.nf
index c3edb434..d2db37a1 100644
--- a/modules/local/pycoqc.nf
+++ b/modules/local/pycoqc/main.nf
@@ -1,7 +1,7 @@
process PYCOQC {
label 'process_medium'
- conda "bioconda::pycoqc=2.5.2"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/pycoqc:2.5.2--py_0' :
'biocontainers/pycoqc:2.5.2--py_0' }"
diff --git a/modules/local/unicycler/environment.yml b/modules/local/unicycler/environment.yml
new file mode 100644
index 00000000..9e32bbc5
--- /dev/null
+++ b/modules/local/unicycler/environment.yml
@@ -0,0 +1,7 @@
+name: unicycler
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - unicycler=0.4.8
diff --git a/modules/local/unicycler.nf b/modules/local/unicycler/main.nf
similarity index 97%
rename from modules/local/unicycler.nf
rename to modules/local/unicycler/main.nf
index 8a045827..eea72381 100644
--- a/modules/local/unicycler.nf
+++ b/modules/local/unicycler/main.nf
@@ -2,7 +2,7 @@ process UNICYCLER {
tag "$meta.id"
label 'process_high'
- conda "bioconda::unicycler=0.4.8"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/unicycler:0.4.8--py38h8162308_3' :
'biocontainers/unicycler:0.4.8--py38h8162308_3' }"
diff --git a/modules/nf-core/bakta/bakta/environment.yml b/modules/nf-core/bakta/bakta/environment.yml
new file mode 100644
index 00000000..efb92265
--- /dev/null
+++ b/modules/nf-core/bakta/bakta/environment.yml
@@ -0,0 +1,7 @@
+name: bakta_bakta
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::bakta=1.9.3
diff --git a/modules/nf-core/bakta/bakta/main.nf b/modules/nf-core/bakta/bakta/main.nf
index fd0b76f2..9a32c3da 100644
--- a/modules/nf-core/bakta/bakta/main.nf
+++ b/modules/nf-core/bakta/bakta/main.nf
@@ -2,10 +2,10 @@ process BAKTA_BAKTA {
tag "$meta.id"
label 'process_medium'
- conda "bioconda::bakta=1.8.2"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
- 'https://depot.galaxyproject.org/singularity/bakta:1.8.2--pyhdfd78af_0' :
- 'biocontainers/bakta:1.8.2--pyhdfd78af_0' }"
+ 'https://depot.galaxyproject.org/singularity/bakta:1.9.3--pyhdfd78af_0' :
+ 'biocontainers/bakta:1.9.3--pyhdfd78af_0' }"
input:
tuple val(meta), path(fasta)
diff --git a/modules/nf-core/bakta/bakta/meta.yml b/modules/nf-core/bakta/bakta/meta.yml
index 0dfa07e2..c0e53e2a 100644
--- a/modules/nf-core/bakta/bakta/meta.yml
+++ b/modules/nf-core/bakta/bakta/meta.yml
@@ -12,7 +12,6 @@ tools:
tool_dev_url: https://github.com/oschwengers/bakta
doi: "10.1099/mgen.0.000685"
licence: ["GPL v3"]
-
input:
- meta:
type: map
@@ -33,7 +32,6 @@ input:
- prodigal_tf:
type: file
description: Training file to use for Prodigal (optional)
-
output:
- meta:
type: map
@@ -84,8 +82,11 @@ output:
type: file
description: hypothetical protein CDS amino acid sequences as FASTA
pattern: "*.hypotheticals.faa"
-
authors:
- "@rpetit3"
- "@oschwengers"
- "@jfy133"
+maintainers:
+ - "@rpetit3"
+ - "@oschwengers"
+ - "@jfy133"
diff --git a/modules/nf-core/bakta/bakta/tests/main.nf.test b/modules/nf-core/bakta/bakta/tests/main.nf.test
new file mode 100644
index 00000000..bdceb16e
--- /dev/null
+++ b/modules/nf-core/bakta/bakta/tests/main.nf.test
@@ -0,0 +1,83 @@
+nextflow_process {
+
+ name "Test Process BAKTA_BAKTA"
+ script "../main.nf"
+ config "./nextflow.config"
+ process "BAKTA_BAKTA"
+
+ tag "modules"
+ tag "modules_nfcore"
+ tag "bakta"
+ tag "bakta/bakta"
+ tag "bakta/baktadbdownload"
+
+ test("Bakta - bacteroides_fragilis - genome.fasta") {
+
+ setup {
+ run("BAKTA_BAKTADBDOWNLOAD") {
+ script "../../baktadbdownload/main.nf"
+ process {
+ """
+ """
+ }
+ }
+ }
+
+ when {
+ process {
+ """
+ input[0] = [
+ [ id:'test', single_end:false ], // meta map
+ file(params.test_data['bacteroides_fragilis']['illumina']['test1_contigs_fa_gz'], checkIfExists: true)
+ ]
+ input[1] = BAKTA_BAKTADBDOWNLOAD.out.db
+ input[2] = []
+ input[3] = []
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert path(process.out.embl.get(0).get(1)).text.contains("/translation=\"MKNTLKIAILLIAIISMGHWMPVKQVCDLNSLSLQNVEALANGET") },
+ { assert path(process.out.faa.get(0).get(1)).text.contains("MKNTLKIAILLIAIISMGHWMPVKQVCDLNSLSLQNVEALANGETPNYTFCIGAGSVDCPIQHDKVKYVSQGFSLDY") },
+ { assert path(process.out.ffn.get(0).get(1)).text.contains("ATGAAAAACACTTTAAAAATAGCTATTCTTCTTATTGCTATTATTTCTATGGGGCATTGGATGCCTGTAAAACAAGT") },
+ { assert path(process.out.fna.get(0).get(1)).text.contains("TCTTTTTACTCATAATCTACTTTTATGATGTTAATTATTTTTTCCGTGTCTCTCTTTCGG") },
+ { assert path(process.out.gbff.get(0).get(1)).text.contains("/translation=\"MKNTLKIAILLIAIISMGHWMPVKQVCDLNSLSLQNVEALANGET") },
+ { assert path(process.out.gff.get(0).get(1)).text.contains("##sequence-region contig_1 1 2926") },
+ { assert path(process.out.hypotheticals_tsv.get(0).get(1)).text.contains("#Annotated with Bakta") },
+ { assert path(process.out.hypotheticals_faa.get(0).get(1)).text.contains("MKNLILVLGCFFFLISCQQTEKEKLEELVKNWNGKEVLL") },
+ { assert path(process.out.tsv.get(0).get(1)).text.contains("SO:0001217, UniRef:UniRef50_A0A0I9S7A3") },
+ { assert path(process.out.txt.get(0).get(1)).text.contains("Length: 1739120") },
+ { assert snapshot(process.out.versions).match("versions") }
+ )
+ }
+
+ }
+
+ test("Bakta - stub") {
+
+ options "-stub"
+
+ when {
+ process {
+ """
+ input[0] = [[id: 'stub'],file('stub')]
+ input[1] = []
+ input[2] = []
+ input[3] = []
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(process.out).match() }
+ )
+ }
+
+ }
+
+}
diff --git a/modules/nf-core/bakta/bakta/tests/main.nf.test.snap b/modules/nf-core/bakta/bakta/tests/main.nf.test.snap
new file mode 100644
index 00000000..40e30c36
--- /dev/null
+++ b/modules/nf-core/bakta/bakta/tests/main.nf.test.snap
@@ -0,0 +1,191 @@
+{
+ "versions": {
+ "content": [
+ [
+ "versions.yml:md5,f8b70ceb2a328c25a190699384e6152d"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.1"
+ },
+ "timestamp": "2024-03-14T09:11:06.657602394"
+ },
+ "Bakta - stub": {
+ "content": [
+ {
+ "0": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.embl:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "1": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.faa:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "10": [
+ "versions.yml:md5,f8b70ceb2a328c25a190699384e6152d"
+ ],
+ "2": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.ffn:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "3": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.fna:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "4": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.gbff:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "5": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.gff3:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "6": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.hypotheticals.tsv:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "7": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.hypotheticals.faa:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "8": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.tsv:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "9": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.txt:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "embl": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.embl:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "faa": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.faa:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "ffn": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.ffn:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "fna": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.fna:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "gbff": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.gbff:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "gff": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.gff3:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "hypotheticals_faa": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.hypotheticals.faa:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "hypotheticals_tsv": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.hypotheticals.tsv:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "tsv": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.tsv:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "txt": [
+ [
+ {
+ "id": "stub"
+ },
+ "stub.txt:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "versions": [
+ "versions.yml:md5,f8b70ceb2a328c25a190699384e6152d"
+ ]
+ }
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.1"
+ },
+ "timestamp": "2024-03-14T09:11:15.532858932"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/bakta/bakta/tests/nextflow.config b/modules/nf-core/bakta/bakta/tests/nextflow.config
new file mode 100644
index 00000000..9af0dde1
--- /dev/null
+++ b/modules/nf-core/bakta/bakta/tests/nextflow.config
@@ -0,0 +1,11 @@
+process {
+
+ withName: 'BAKTA_BAKTADBDOWNLOAD' {
+ ext.args = "--type light"
+ }
+
+ withName: 'BAKTA_BAKTA' {
+ memory = 7.GB
+ }
+
+}
diff --git a/modules/nf-core/bakta/bakta/tests/tags.yml b/modules/nf-core/bakta/bakta/tests/tags.yml
new file mode 100644
index 00000000..ecb08c45
--- /dev/null
+++ b/modules/nf-core/bakta/bakta/tests/tags.yml
@@ -0,0 +1,2 @@
+bakta/bakta:
+ - "modules/nf-core/bakta/bakta/**"
diff --git a/modules/nf-core/bakta/baktadbdownload/environment.yml b/modules/nf-core/bakta/baktadbdownload/environment.yml
index 102348df..f6a53ff7 100644
--- a/modules/nf-core/bakta/baktadbdownload/environment.yml
+++ b/modules/nf-core/bakta/baktadbdownload/environment.yml
@@ -1,6 +1,7 @@
+name: bakta_baktadbdownload
channels:
- conda-forge
- bioconda
- defaults
dependencies:
- - bioconda::bakta=1.8.2
+ - bioconda::bakta=1.9.3
diff --git a/modules/nf-core/bakta/baktadbdownload/main.nf b/modules/nf-core/bakta/baktadbdownload/main.nf
index 4c111045..e512d77d 100644
--- a/modules/nf-core/bakta/baktadbdownload/main.nf
+++ b/modules/nf-core/bakta/baktadbdownload/main.nf
@@ -1,10 +1,10 @@
process BAKTA_BAKTADBDOWNLOAD {
label 'process_single'
- conda 'modules/nf-core/bakta/baktadbdownload/environment.yml'
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
- 'https://depot.galaxyproject.org/singularity/bakta:1.8.2--pyhdfd78af_0' :
- 'biocontainers/bakta:1.8.2--pyhdfd78af_0' }"
+ 'https://depot.galaxyproject.org/singularity/bakta:1.9.3--pyhdfd78af_0' :
+ 'biocontainers/bakta:1.9.3--pyhdfd78af_0' }"
output:
path "db*" , emit: db
diff --git a/modules/nf-core/bakta/baktadbdownload/tests/main.nf.test b/modules/nf-core/bakta/baktadbdownload/tests/main.nf.test
new file mode 100644
index 00000000..a5f827f9
--- /dev/null
+++ b/modules/nf-core/bakta/baktadbdownload/tests/main.nf.test
@@ -0,0 +1,55 @@
+nextflow_process {
+
+ name "Test Process BAKTA_BAKTADBDOWNLOAD"
+ script "../main.nf"
+ process "BAKTA_BAKTADBDOWNLOAD"
+ config "./nextflow.config"
+
+ tag "modules"
+ tag "modules_nfcore"
+ tag "bakta"
+ tag "bakta/baktadbdownload"
+
+ test("Bakta database download") {
+
+ when {
+ process {
+ """
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert path(process.out.db.get(0)).exists() },
+ { assert snapshot(process.out.versions).match() }
+ )
+ }
+
+ }
+
+ test("Bakta database download - stub") {
+
+ options "-stub"
+
+ when {
+ process {
+ """
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(
+ process.out.db +
+ process.out.versions
+ ).match() }
+ )
+ }
+
+ }
+
+}
diff --git a/modules/nf-core/bakta/baktadbdownload/tests/main.nf.test.snap b/modules/nf-core/bakta/baktadbdownload/tests/main.nf.test.snap
new file mode 100644
index 00000000..b1c82267
--- /dev/null
+++ b/modules/nf-core/bakta/baktadbdownload/tests/main.nf.test.snap
@@ -0,0 +1,29 @@
+{
+ "Bakta database download": {
+ "content": [
+ [
+ "versions.yml:md5,df9b091b08a41b7d5eef95727b7eac29"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.1"
+ },
+ "timestamp": "2024-03-19T11:34:41.812416438"
+ },
+ "Bakta database download - stub": {
+ "content": [
+ [
+ [
+
+ ],
+ "versions.yml:md5,df9b091b08a41b7d5eef95727b7eac29"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.1"
+ },
+ "timestamp": "2024-03-19T11:35:01.082923401"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/bakta/baktadbdownload/tests/nextflow.config b/modules/nf-core/bakta/baktadbdownload/tests/nextflow.config
new file mode 100644
index 00000000..8b99646a
--- /dev/null
+++ b/modules/nf-core/bakta/baktadbdownload/tests/nextflow.config
@@ -0,0 +1,7 @@
+process {
+
+ withName: 'BAKTA_BAKTADBDOWNLOAD' {
+ ext.args = "--type light"
+ }
+
+}
diff --git a/modules/nf-core/bakta/baktadbdownload/tests/tags.yml b/modules/nf-core/bakta/baktadbdownload/tests/tags.yml
new file mode 100644
index 00000000..c469fa48
--- /dev/null
+++ b/modules/nf-core/bakta/baktadbdownload/tests/tags.yml
@@ -0,0 +1,2 @@
+bakta/baktadbdownload:
+ - "modules/nf-core/bakta/baktadbdownload/**"
diff --git a/modules/nf-core/dragonflye/environment.yml b/modules/nf-core/dragonflye/environment.yml
index 7899d46d..21a90517 100644
--- a/modules/nf-core/dragonflye/environment.yml
+++ b/modules/nf-core/dragonflye/environment.yml
@@ -1,3 +1,4 @@
+name: dragonflye
channels:
- conda-forge
- bioconda
diff --git a/modules/nf-core/dragonflye/main.nf b/modules/nf-core/dragonflye/main.nf
index 4ed9f7f0..f4339c91 100644
--- a/modules/nf-core/dragonflye/main.nf
+++ b/modules/nf-core/dragonflye/main.nf
@@ -2,7 +2,7 @@ process DRAGONFLYE {
tag "$meta.id"
label 'process_medium'
- conda 'modules/nf-core/dragonflye/environment.yml'
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/dragonflye:1.1.2--hdfd78af_0' :
'biocontainers/dragonflye:1.1.2--hdfd78af_0' }"
@@ -11,27 +11,27 @@ process DRAGONFLYE {
tuple val(meta), path(shortreads), path(longreads)
output:
- tuple val(meta), path("*.contigs.fa") , emit: contigs
- tuple val(meta), path("dragonflye.log") , emit: log
- tuple val(meta), path("{flye,miniasm,raven}.fasta") , emit: raw_contigs
- tuple val(meta), path("{flye,miniasm,raven}-unpolished.gfa"), optional:true, emit: gfa
- tuple val(meta), path("flye-info.txt"), optional:true , emit: txt
- path "versions.yml" , emit: versions
+ tuple val(meta), path("*.fa") , emit: contigs
+ tuple val(meta), path("dragonflye.log") , emit: log
+ tuple val(meta), path("{flye,miniasm,raven}.fasta") , emit: raw_contigs
+ tuple val(meta), path("{flye,miniasm,raven}-unpolished.gfa"), optional:true , emit: gfa
+ tuple val(meta), path("flye-info.txt") , optional:true , emit: txt
+ path "versions.yml" , emit: versions
when:
task.ext.when == null || task.ext.when
script:
- def args = task.ext.args ?: ''
- def prefix = task.ext.prefix ?: "${meta.id}"
- def memory = task.memory.toGiga()
- def short_polishing = shortreads ? "--R1 ${shortreads[0]} --R2 ${shortreads[1]}" : ''
+ def args = task.ext.args ?: ''
+ def prefix = task.ext.prefix ?: "${meta.id}"
+ def memory = task.memory.toGiga()
+ def shortreads_polishing = shortreads ? "--R1 ${shortreads[0]} --R2 ${shortreads[1]}" : ''
"""
dragonflye \\
--reads ${longreads} \\
- $short_polishing \\
+ $shortreads_polishing \\
$args \\
- --prefix ${prefix}.contigs \\
+ --prefix ${prefix} \\
--cpus $task.cpus \\
--ram $memory \\
--outdir ./ \\
diff --git a/modules/nf-core/dragonflye/meta.yml b/modules/nf-core/dragonflye/meta.yml
index 4c3b9405..60ccad45 100644
--- a/modules/nf-core/dragonflye/meta.yml
+++ b/modules/nf-core/dragonflye/meta.yml
@@ -16,9 +16,14 @@ input:
description: |
Groovy Map containing sample information
e.g. [ id:'test', single_end:false ]
- - reads:
+ - shortreads:
type: file
- description: Input Nanopore FASTQ file. Optional, additional Illumina FASTQ files can be provided to perform short reads polishing.
+ description: |
+ Optional. List of FastQ files of short reads (paired-end data) that will be used to polish the draft genome.
+ pattern: "*.fastq.gz"
+ - longreads:
+ type: file
+ description: Input Nanopore FASTQ file
pattern: "*.fastq.gz"
output:
- meta:
@@ -33,7 +38,7 @@ output:
- contigs:
type: file
description: The final assembly produced by Dragonflye
- pattern: "contigs.fa"
+ pattern: "*.fa"
- log:
type: file
description: Full log file for bug reporting
@@ -49,7 +54,7 @@ output:
- gfa:
type: file
description: Assembly graph produced by Miniasm, or Raven
- pattern: "{miniasm,raven}-unpolished.gfa"
+ pattern: "{flye,miniasm,raven}-unpolished.gfa"
authors:
- "@rpetit3"
maintainers:
diff --git a/modules/nf-core/dragonflye/tests/main.nf.test b/modules/nf-core/dragonflye/tests/main.nf.test
index 1eadc7f4..46f2a550 100644
--- a/modules/nf-core/dragonflye/tests/main.nf.test
+++ b/modules/nf-core/dragonflye/tests/main.nf.test
@@ -19,7 +19,8 @@ nextflow_process {
"""
input[0] = [ [ id:'test', single_end:true ], // meta map
- [ file("https://github.com/nf-core/test-datasets/raw/bacass/nanopore/subset15000.fq.gz", checkIfExists: true) ]
+ [],
+ file("https://github.com/nf-core/test-datasets/raw/bacass/nanopore/subset15000.fq.gz", checkIfExists: true)
]
"""
}
@@ -32,7 +33,7 @@ nextflow_process {
{ assert snapshot(process.out.gfa).match("miniasm_gfa") },
{ assert snapshot(process.out.versions).match("versions") },
// MD5sum not reproducible (timestamp, contig order)
- { assert new File("${outputDir}/dragonflye/contigs.fa").exists() },
+ { assert new File("${outputDir}/dragonflye/test.fa").exists() },
{ assert new File("${outputDir}/dragonflye/dragonflye.log").exists() }
)
@@ -53,7 +54,8 @@ nextflow_process {
"""
input[0] = [ [ id:'test', single_end:true ], // meta map
- [ file("https://github.com/nf-core/test-datasets/raw/bacass/nanopore/subset15000.fq.gz", checkIfExists: true) ]
+ [],
+ file("https://github.com/nf-core/test-datasets/raw/bacass/nanopore/subset15000.fq.gz", checkIfExists: true)
]
"""
}
@@ -64,7 +66,7 @@ nextflow_process {
{ assert process.success },
{ assert snapshot(process.out.versions).match("versions") },
// MD5sum not reproducible (timestamp, contig order)
- { assert new File("${outputDir}/dragonflye/contigs.fa").exists() },
+ { assert new File("${outputDir}/dragonflye/test.fa").exists() },
{ assert new File("${outputDir}/dragonflye/dragonflye.log").exists() },
{ assert new File("${outputDir}/dragonflye/raven.fasta").exists() },
{ assert new File("${outputDir}/dragonflye/raven-unpolished.gfa").exists() },
@@ -75,4 +77,36 @@ nextflow_process {
}
+ test("Dragonflye hybrid") {
+ config "./nextflow.hybrid.config"
+
+ when {
+ params {
+ outdir = "$outputDir"
+ }
+ process {
+ """
+
+ input[0] = [ [ id:'test', single_end:false ], // meta map
+ [ file("https://github.com/nf-core/test-datasets/raw/bacass/A1403KPN_R1.fastq.gz"), file("https://github.com/nf-core/test-datasets/raw/bacass/A1403KPN_R2.fastq.gz") ], // short reads for polishing
+ file("https://github.com/nf-core/test-datasets/raw/bacass/nanopore/A1403KPN.fq.gz", checkIfExists: true)
+ ]
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(process.out.raw_contigs).match("hybrid_raw_contigs") },
+ { assert snapshot(process.out.gfa).match("hybrid_gfa") },
+ { assert snapshot(process.out.versions).match("versions") },
+ // MD5sum not reproducible (timestamp, contig order)
+ { assert new File("${outputDir}/dragonflye/test.fa").exists() },
+ { assert new File("${outputDir}/dragonflye/dragonflye.log").exists() }
+
+ )
+ }
+
+ }
}
diff --git a/modules/nf-core/dragonflye/tests/main.nf.test.snap b/modules/nf-core/dragonflye/tests/main.nf.test.snap
index 64acac41..64461756 100644
--- a/modules/nf-core/dragonflye/tests/main.nf.test.snap
+++ b/modules/nf-core/dragonflye/tests/main.nf.test.snap
@@ -2,10 +2,10 @@
"versions": {
"content": [
[
- "versions.yml:md5,96447a7a742e9ea4f497dd4d19bf5d1b"
+ "versions.yml:md5,308f2552548d82b74ed923e3b7fd0c87"
]
],
- "timestamp": "2023-10-19T08:04:24.882463835"
+ "timestamp": "2023-11-10 13:25:06.318835345+0100"
},
"miniasm_raw_contigs": {
"content": [
@@ -34,5 +34,33 @@
]
],
"timestamp": "2023-10-19T08:04:24.863920486"
+ },
+ "hybrid_raw_contigs": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "miniasm.fasta:md5,2975f61771d44f9f5758be05391e95bb"
+ ]
+ ]
+ ],
+ "timestamp": "2023-11-10 13:55:33.902108477+0100"
+ },
+ "hybrid_gfa": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "miniasm-unpolished.gfa:md5,582c59bd7eb9af1fec673d4ecf1772e9"
+ ]
+ ]
+ ],
+ "timestamp": "2023-11-10 13:54:30.857934106+0100"
}
-}
\ No newline at end of file
+}
diff --git a/modules/nf-core/dragonflye/tests/nextflow.hybrid.config b/modules/nf-core/dragonflye/tests/nextflow.hybrid.config
new file mode 100644
index 00000000..683cf8ab
--- /dev/null
+++ b/modules/nf-core/dragonflye/tests/nextflow.hybrid.config
@@ -0,0 +1,4 @@
+process {
+ publishDir = { "${params.outdir}/${task.process.tokenize(':')[-1].tokenize('_')[0].toLowerCase()}" }
+ ext.args = '--assembler miniasm -gsize 5000000'
+}
diff --git a/modules/nf-core/fastp/main.nf b/modules/nf-core/fastp/main.nf
index 2a3b679e..4fc19b74 100644
--- a/modules/nf-core/fastp/main.nf
+++ b/modules/nf-core/fastp/main.nf
@@ -29,7 +29,7 @@ process FASTP {
def args = task.ext.args ?: ''
def prefix = task.ext.prefix ?: "${meta.id}"
def adapter_list = adapter_fasta ? "--adapter_fasta ${adapter_fasta}" : ""
- def fail_fastq = save_trimmed_fail && meta.single_end ? "--failed_out ${prefix}.fail.fastq.gz" : save_trimmed_fail && !meta.single_end ? "--unpaired1 ${prefix}_1.fail.fastq.gz --unpaired2 ${prefix}_2.fail.fastq.gz" : ''
+ def fail_fastq = save_trimmed_fail && meta.single_end ? "--failed_out ${prefix}.fail.fastq.gz" : save_trimmed_fail && !meta.single_end ? "--failed_out ${prefix}.paired.fail.fastq.gz --unpaired1 ${prefix}_1.fail.fastq.gz --unpaired2 ${prefix}_2.fail.fastq.gz" : ''
// Added soft-links to original fastqs for consistent naming in MultiQC
// Use single ended for interleaved. Add --interleaved_in in config.
if ( task.ext.args?.contains('--interleaved_in') ) {
diff --git a/modules/nf-core/fastp/tests/main.nf.test b/modules/nf-core/fastp/tests/main.nf.test
index 9b3f9a38..6f1f4897 100644
--- a/modules/nf-core/fastp/tests/main.nf.test
+++ b/modules/nf-core/fastp/tests/main.nf.test
@@ -251,7 +251,8 @@ nextflow_process {
}
test("fastp test_fastp_interleaved") {
- config './nextflow.config'
+
+ config './nextflow.interleaved.config'
when {
params {
outdir = "$outputDir"
@@ -277,7 +278,7 @@ nextflow_process {
def html_text = [ "Q20 bases:
25.719000 K (93.033098%)",
"paired end (151 cycles + 151 cycles)"]
def log_text = [ "Q20 bases: 12922(92.9841%)",
- "reads passed filter: 198"]
+ "reads passed filter: 162"]
def read_lines = [ "@ERR5069949.2151832 NS500628:121:HK3MMAFX2:2:21208:10793:15304/1",
"TCATAAACCAAAGCACTCACAGTGTCAACAATTTCAGCAGGACAACGCCGACAAGTTCCGAGGAACATGTCTGGACCTATAGTTTTCATAAGTCTACACACTGAATTGAAATATTCTGGTTCTAGTGTGCCCTTAGTTAGCAATGTGCGT",
"AAAAAAEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEAAEEEEAEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEAAEEEEE
- { assert path(process.out.reads_fail.get(0).get(1).get(1)).linesGzip.contains(failed_read2_line) }
+ { assert path(process.out.reads_fail.get(0).get(1).get(2)).linesGzip.contains(failed_read2_line) }
}
},
{ html_text.each { html_part ->
diff --git a/modules/nf-core/fastp/tests/main.nf.test.snap b/modules/nf-core/fastp/tests/main.nf.test.snap
index b4c0e1dd..3e876288 100644
--- a/modules/nf-core/fastp/tests/main.nf.test.snap
+++ b/modules/nf-core/fastp/tests/main.nf.test.snap
@@ -7,7 +7,7 @@
"id": "test",
"single_end": true
},
- "test.fastp.json:md5,168f516f7bd4b7b6c32da7cba87299a4"
+ "test.fastp.json:md5,b24e0624df5cc0b11cd5ba21b726fb22"
]
]
],
@@ -15,7 +15,7 @@
"nf-test": "0.8.4",
"nextflow": "23.10.1"
},
- "timestamp": "2024-01-17T18:08:06.123035"
+ "timestamp": "2024-03-18T16:19:15.063001"
},
"test_fastp_paired_end_merged-for_stub_match": {
"content": [
@@ -65,7 +65,7 @@
"nf-test": "0.8.4",
"nextflow": "23.10.1"
},
- "timestamp": "2024-01-17T18:06:00.223817"
+ "timestamp": "2024-03-18T16:18:43.526412"
},
"versions_paired_end": {
"content": [
@@ -112,7 +112,7 @@
"nf-test": "0.8.4",
"nextflow": "23.10.1"
},
- "timestamp": "2024-02-01T12:03:37.827323085"
+ "timestamp": "2024-03-18T16:19:15.111894"
},
"test_fastp_paired_end_merged_match": {
"content": [
@@ -283,7 +283,7 @@
"nf-test": "0.8.4",
"nextflow": "23.10.1"
},
- "timestamp": "2024-02-01T11:57:30.791982648"
+ "timestamp": "2024-03-18T16:18:43.580336"
},
"versions_paired_end_merged_adapterlist": {
"content": [
diff --git a/modules/nf-core/fastp/tests/nextflow.interleaved.config b/modules/nf-core/fastp/tests/nextflow.interleaved.config
new file mode 100644
index 00000000..4be8dbd2
--- /dev/null
+++ b/modules/nf-core/fastp/tests/nextflow.interleaved.config
@@ -0,0 +1,5 @@
+process {
+ withName: FASTP {
+ ext.args = "--interleaved_in -e 30"
+ }
+}
diff --git a/modules/nf-core/fastp/tests/nextflow.config b/modules/nf-core/fastp/tests/nextflow.save_failed.config
similarity index 50%
rename from modules/nf-core/fastp/tests/nextflow.config
rename to modules/nf-core/fastp/tests/nextflow.save_failed.config
index 0f7849ad..53b61b0c 100644
--- a/modules/nf-core/fastp/tests/nextflow.config
+++ b/modules/nf-core/fastp/tests/nextflow.save_failed.config
@@ -1,6 +1,5 @@
process {
-
withName: FASTP {
- ext.args = "--interleaved_in"
+ ext.args = "-e 30"
}
}
diff --git a/modules/nf-core/gunzip/environment.yml b/modules/nf-core/gunzip/environment.yml
new file mode 100644
index 00000000..25910b34
--- /dev/null
+++ b/modules/nf-core/gunzip/environment.yml
@@ -0,0 +1,7 @@
+name: gunzip
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - conda-forge::sed=4.7
diff --git a/modules/nf-core/gunzip/main.nf b/modules/nf-core/gunzip/main.nf
index 73bf08cd..468a6f28 100644
--- a/modules/nf-core/gunzip/main.nf
+++ b/modules/nf-core/gunzip/main.nf
@@ -2,7 +2,7 @@ process GUNZIP {
tag "$archive"
label 'process_single'
- conda "conda-forge::sed=4.7"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/ubuntu:20.04' :
'nf-core/ubuntu:20.04' }"
diff --git a/modules/nf-core/gunzip/meta.yml b/modules/nf-core/gunzip/meta.yml
index 4cdcdf4c..231034f2 100644
--- a/modules/nf-core/gunzip/meta.yml
+++ b/modules/nf-core/gunzip/meta.yml
@@ -33,3 +33,7 @@ authors:
- "@joseespinosa"
- "@drpatelh"
- "@jfy133"
+maintainers:
+ - "@joseespinosa"
+ - "@drpatelh"
+ - "@jfy133"
diff --git a/modules/nf-core/gunzip/tests/main.nf.test b/modules/nf-core/gunzip/tests/main.nf.test
new file mode 100644
index 00000000..6406008e
--- /dev/null
+++ b/modules/nf-core/gunzip/tests/main.nf.test
@@ -0,0 +1,36 @@
+nextflow_process {
+
+ name "Test Process GUNZIP"
+ script "../main.nf"
+ process "GUNZIP"
+ tag "gunzip"
+ tag "modules_nfcore"
+ tag "modules"
+
+ test("Should run without failures") {
+
+ when {
+ params {
+ outdir = "$outputDir"
+ }
+ process {
+ """
+ input[0] = Channel.of([
+ [],
+ file(params.modules_testdata_base_path + 'genomics/sarscov2/illumina/fastq/test_1.fastq.gz', checkIfExists: true)
+ ]
+ )
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(process.out).match() }
+ )
+ }
+
+ }
+
+}
diff --git a/modules/nf-core/gunzip/tests/main.nf.test.snap b/modules/nf-core/gunzip/tests/main.nf.test.snap
new file mode 100644
index 00000000..720fd9ff
--- /dev/null
+++ b/modules/nf-core/gunzip/tests/main.nf.test.snap
@@ -0,0 +1,31 @@
+{
+ "Should run without failures": {
+ "content": [
+ {
+ "0": [
+ [
+ [
+
+ ],
+ "test_1.fastq:md5,4161df271f9bfcd25d5845a1e220dbec"
+ ]
+ ],
+ "1": [
+ "versions.yml:md5,54376d32aca20e937a4ec26dac228e84"
+ ],
+ "gunzip": [
+ [
+ [
+
+ ],
+ "test_1.fastq:md5,4161df271f9bfcd25d5845a1e220dbec"
+ ]
+ ],
+ "versions": [
+ "versions.yml:md5,54376d32aca20e937a4ec26dac228e84"
+ ]
+ }
+ ],
+ "timestamp": "2023-10-17T15:35:37.690477896"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/gunzip/tests/tags.yml b/modules/nf-core/gunzip/tests/tags.yml
new file mode 100644
index 00000000..fd3f6915
--- /dev/null
+++ b/modules/nf-core/gunzip/tests/tags.yml
@@ -0,0 +1,2 @@
+gunzip:
+ - modules/nf-core/gunzip/**
diff --git a/modules/nf-core/kraken2/kraken2/environment.yml b/modules/nf-core/kraken2/kraken2/environment.yml
new file mode 100644
index 00000000..63be419b
--- /dev/null
+++ b/modules/nf-core/kraken2/kraken2/environment.yml
@@ -0,0 +1,8 @@
+name: kraken2_kraken2
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::kraken2=2.1.2
+ - conda-forge::pigz=2.6
diff --git a/modules/nf-core/kraken2/kraken2/main.nf b/modules/nf-core/kraken2/kraken2/main.nf
index da8d8c6d..92cd9c34 100644
--- a/modules/nf-core/kraken2/kraken2/main.nf
+++ b/modules/nf-core/kraken2/kraken2/main.nf
@@ -2,7 +2,7 @@ process KRAKEN2_KRAKEN2 {
tag "$meta.id"
label 'process_high'
- conda "bioconda::kraken2=2.1.2 conda-forge::pigz=2.6"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/mulled-v2-5799ab18b5fc681e75923b2450abaa969907ec98:87fc08d11968d081f3e8a37131c1f1f6715b6542-0' :
'biocontainers/mulled-v2-5799ab18b5fc681e75923b2450abaa969907ec98:87fc08d11968d081f3e8a37131c1f1f6715b6542-0' }"
@@ -55,4 +55,31 @@ process KRAKEN2_KRAKEN2 {
pigz: \$( pigz --version 2>&1 | sed 's/pigz //g' )
END_VERSIONS
"""
+
+ stub:
+ def args = task.ext.args ?: ''
+ def prefix = task.ext.prefix ?: "${meta.id}"
+ def paired = meta.single_end ? "" : "--paired"
+ def classified = meta.single_end ? "${prefix}.classified.fastq.gz" : "${prefix}.classified_1.fastq.gz ${prefix}.classified_2.fastq.gz"
+ def unclassified = meta.single_end ? "${prefix}.unclassified.fastq.gz" : "${prefix}.unclassified_1.fastq.gz ${prefix}.unclassified_2.fastq.gz"
+ def readclassification_option = save_reads_assignment ? "--output ${prefix}.kraken2.classifiedreads.txt" : "--output /dev/null"
+ def compress_reads_command = save_output_fastqs ? "pigz -p $task.cpus *.fastq" : ""
+
+ """
+ touch ${prefix}.kraken2.report.txt
+ if [ "$save_output_fastqs" == "true" ]; then
+ touch $classified
+ touch $unclassified
+ fi
+ if [ "$save_reads_assignment" == "true" ]; then
+ touch ${prefix}.kraken2.classifiedreads.txt
+ fi
+
+ cat <<-END_VERSIONS > versions.yml
+ "${task.process}":
+ kraken2: \$(echo \$(kraken2 --version 2>&1) | sed 's/^.*Kraken version //; s/ .*\$//')
+ pigz: \$( pigz --version 2>&1 | sed 's/pigz //g' )
+ END_VERSIONS
+ """
+
}
diff --git a/modules/nf-core/kraken2/kraken2/meta.yml b/modules/nf-core/kraken2/kraken2/meta.yml
index 4721f45b..7909ffe7 100644
--- a/modules/nf-core/kraken2/kraken2/meta.yml
+++ b/modules/nf-core/kraken2/kraken2/meta.yml
@@ -73,3 +73,6 @@ output:
authors:
- "@joseespinosa"
- "@drpatelh"
+maintainers:
+ - "@joseespinosa"
+ - "@drpatelh"
diff --git a/modules/nf-core/kraken2/kraken2/tests/main.nf.test b/modules/nf-core/kraken2/kraken2/tests/main.nf.test
new file mode 100644
index 00000000..4c513021
--- /dev/null
+++ b/modules/nf-core/kraken2/kraken2/tests/main.nf.test
@@ -0,0 +1,143 @@
+nextflow_process {
+ name "Test Process KRAKEN2_KRAKEN2"
+ script "../main.nf"
+ process "KRAKEN2_KRAKEN2"
+ tag "modules"
+ tag "modules_nfcore"
+ tag "untar"
+ tag "kraken2"
+ tag "kraken2/kraken2"
+
+ setup {
+ run("UNTAR") {
+ script "modules/nf-core/untar/main.nf"
+ process {
+ """
+ input[0] = Channel.of([
+ [],
+ file(
+ params.test_data['sarscov2']['genome']['kraken2_tar_gz'],
+ checkIfExists: true
+ )
+ ])
+ """
+ }
+ }
+ }
+
+ test("sarscov2 illumina single end [fastq]") {
+ when {
+ process {
+ """
+ input[0] = [
+ [ id:'test', single_end:true ], // meta map
+ [ file(
+ params.test_data['sarscov2']['illumina']['test_1_fastq_gz'],
+ checkIfExists: true
+ )]
+ ]
+ input[1] = UNTAR.out.untar.map{ it[1] }
+ input[2] = true
+ input[3] = false
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(
+ process.out.report,
+ process.out.versions,
+ ).match()
+ },
+ { assert process.out.classified_reads_fastq.get(0).get(1) ==~ ".*/test.classified.fastq.gz" },
+ { assert process.out.unclassified_reads_fastq.get(0).get(1) ==~ ".*/test.unclassified.fastq.gz" },
+ )
+ }
+ }
+
+ test("sarscov2 illumina paired end [fastq]") {
+ when {
+ params {
+ outdir = "$outputDir"
+ }
+
+ process {
+ """
+ input[0] = [
+ [ id:'test', single_end:false ], // meta map
+ [
+ file(
+ params.test_data['sarscov2']['illumina']['test_1_fastq_gz'],
+ checkIfExists: true
+ ),
+ file(
+ params.test_data['sarscov2']['illumina']['test_2_fastq_gz'],
+ checkIfExists: true
+ )
+
+ ]
+ ]
+ input[1] = UNTAR.out.untar.map{ it[1] }
+ input[2] = true
+ input[3] = false
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(
+ process.out.report,
+ process.out.versions,
+ ).match()
+ },
+ { assert process.out.classified_reads_fastq.get(0).get(1).get(0)
+ ==~ ".*/test.classified_1.fastq.gz" },
+ { assert process.out.classified_reads_fastq.get(0).get(1).get(1)
+ ==~ ".*/test.classified_2.fastq.gz" },
+ { assert process.out.unclassified_reads_fastq.get(0).get(1).get(0)
+ ==~ ".*/test.unclassified_1.fastq.gz" },
+ { assert process.out.unclassified_reads_fastq.get(0).get(1).get(1)
+ ==~ ".*/test.unclassified_2.fastq.gz" },
+ )
+ }
+ }
+
+ test("sarscov2 illumina single end [fastq] + save_reads_assignment") {
+ when {
+ params {
+ outdir = "$outputDir"
+ }
+
+ process {
+ """
+ input[0] = [
+ [ id:'test', single_end:true ], // meta map
+ [ file(
+ params.test_data['sarscov2']['illumina']['test_1_fastq_gz'],
+ checkIfExists: true
+ )]
+ ]
+ input[1] = UNTAR.out.untar.map{ it[1] }
+ input[2] = false
+ input[3] = true
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(
+ process.out.report,
+ process.out.classified_reads_assignment,
+ process.out.versions,
+ ).match()
+ },
+ )
+ }
+ }
+}
diff --git a/modules/nf-core/kraken2/kraken2/tests/main.nf.test.snap b/modules/nf-core/kraken2/kraken2/tests/main.nf.test.snap
new file mode 100644
index 00000000..c1bdd0c6
--- /dev/null
+++ b/modules/nf-core/kraken2/kraken2/tests/main.nf.test.snap
@@ -0,0 +1,62 @@
+{
+ "sarscov2 illumina single end [fastq]": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": true
+ },
+ "test.kraken2.report.txt:md5,4227755fe40478b8d7dc8634b489761e"
+ ]
+ ],
+ [
+ "versions.yml:md5,bcb3e2520685846df02bb27cc6b1794b"
+ ]
+ ],
+ "timestamp": "2023-10-25T09:01:29.775797"
+ },
+ "sarscov2 illumina paired end [fastq]": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.kraken2.report.txt:md5,4227755fe40478b8d7dc8634b489761e"
+ ]
+ ],
+ [
+ "versions.yml:md5,bcb3e2520685846df02bb27cc6b1794b"
+ ]
+ ],
+ "timestamp": "2023-10-25T09:01:37.025389"
+ },
+ "sarscov2 illumina single end [fastq] + save_reads_assignment": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": true
+ },
+ "test.kraken2.report.txt:md5,4227755fe40478b8d7dc8634b489761e"
+ ]
+ ],
+ [
+ [
+ {
+ "id": "test",
+ "single_end": true
+ },
+ "test.kraken2.classifiedreads.txt:md5,e7a90531f0d8d777316515c36fe4cae0"
+ ]
+ ],
+ [
+ "versions.yml:md5,bcb3e2520685846df02bb27cc6b1794b"
+ ]
+ ],
+ "timestamp": "2023-10-25T09:01:45.775262"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/kraken2/kraken2/tests/tags.yml b/modules/nf-core/kraken2/kraken2/tests/tags.yml
new file mode 100644
index 00000000..9ebfd7ab
--- /dev/null
+++ b/modules/nf-core/kraken2/kraken2/tests/tags.yml
@@ -0,0 +1,3 @@
+kraken2/kraken2:
+ - modules/nf-core/kraken2/kraken2/**
+ - modules/nf-core/untar/**
diff --git a/modules/nf-core/miniasm/environment.yml b/modules/nf-core/miniasm/environment.yml
new file mode 100644
index 00000000..34a35e5d
--- /dev/null
+++ b/modules/nf-core/miniasm/environment.yml
@@ -0,0 +1,7 @@
+name: miniasm
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::miniasm=0.3_r179
diff --git a/modules/nf-core/miniasm/main.nf b/modules/nf-core/miniasm/main.nf
index 99b44992..d4ee470e 100644
--- a/modules/nf-core/miniasm/main.nf
+++ b/modules/nf-core/miniasm/main.nf
@@ -2,7 +2,7 @@ process MINIASM {
tag "$meta.id"
label 'process_high'
- conda "bioconda::miniasm=0.3_r179"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/miniasm:0.3_r179--h5bf99c6_2' :
'biocontainers/miniasm:0.3_r179--h5bf99c6_2' }"
diff --git a/modules/nf-core/miniasm/meta.yml b/modules/nf-core/miniasm/meta.yml
index 59865945..9387eea6 100644
--- a/modules/nf-core/miniasm/meta.yml
+++ b/modules/nf-core/miniasm/meta.yml
@@ -12,7 +12,6 @@ tools:
tool_dev_url: https://github.com/lh3/miniasm
doi: "10.1093/bioinformatics/btw152"
licence: ["MIT"]
-
input:
- meta:
type: map
@@ -27,7 +26,6 @@ input:
type: file
description: Alignment in PAF format
pattern: "*{.paf,.paf.gz}"
-
output:
- meta:
type: map
@@ -46,6 +44,7 @@ output:
type: file
description: Genome assembly
pattern: "*.fasta.gz"
-
authors:
- "@avantonder"
+maintainers:
+ - "@avantonder"
diff --git a/modules/nf-core/minimap2/align/environment.yml b/modules/nf-core/minimap2/align/environment.yml
new file mode 100644
index 00000000..cf6e775f
--- /dev/null
+++ b/modules/nf-core/minimap2/align/environment.yml
@@ -0,0 +1,9 @@
+name: minimap2_align
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::minimap2=2.24
+ - bioconda::samtools=1.18
+ - bioconda::htslib=1.18
diff --git a/modules/nf-core/minimap2/align/main.nf b/modules/nf-core/minimap2/align/main.nf
index 4da47c18..661bd23d 100644
--- a/modules/nf-core/minimap2/align/main.nf
+++ b/modules/nf-core/minimap2/align/main.nf
@@ -3,14 +3,14 @@ process MINIMAP2_ALIGN {
label 'process_medium'
// Note: the versions here need to match the versions used in the mulled container below and minimap2/index
- conda "bioconda::minimap2=2.24 bioconda::samtools=1.14"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
- 'https://depot.galaxyproject.org/singularity/mulled-v2-66534bcbb7031a148b13e2ad42583020b9cd25c4:1679e915ddb9d6b4abda91880c4b48857d471bd8-0' :
- 'biocontainers/mulled-v2-66534bcbb7031a148b13e2ad42583020b9cd25c4:1679e915ddb9d6b4abda91880c4b48857d471bd8-0' }"
+ 'https://depot.galaxyproject.org/singularity/mulled-v2-66534bcbb7031a148b13e2ad42583020b9cd25c4:365b17b986c1a60c1b82c6066a9345f38317b763-0' :
+ 'biocontainers/mulled-v2-66534bcbb7031a148b13e2ad42583020b9cd25c4:365b17b986c1a60c1b82c6066a9345f38317b763-0' }"
input:
tuple val(meta), path(reads)
- path reference
+ tuple val(meta2), path(reference)
val bam_format
val cigar_paf_format
val cigar_bam
@@ -24,22 +24,35 @@ process MINIMAP2_ALIGN {
task.ext.when == null || task.ext.when
script:
- def args = task.ext.args ?: ''
+ def args = task.ext.args ?: ''
+ def args2 = task.ext.args2 ?: ''
def prefix = task.ext.prefix ?: "${meta.id}"
- def bam_output = bam_format ? "-a | samtools sort | samtools view -@ ${task.cpus} -b -h -o ${prefix}.bam" : "-o ${prefix}.paf"
+ def bam_output = bam_format ? "-a | samtools sort -@ ${task.cpus} -o ${prefix}.bam ${args2}" : "-o ${prefix}.paf"
def cigar_paf = cigar_paf_format && !bam_format ? "-c" : ''
def set_cigar_bam = cigar_bam && bam_format ? "-L" : ''
"""
minimap2 \\
$args \\
-t $task.cpus \\
- "${reference ?: reads}" \\
- "$reads" \\
+ ${reference ?: reads} \\
+ $reads \\
$cigar_paf \\
$set_cigar_bam \\
$bam_output
+ cat <<-END_VERSIONS > versions.yml
+ "${task.process}":
+ minimap2: \$(minimap2 --version 2>&1)
+ END_VERSIONS
+ """
+
+ stub:
+ def prefix = task.ext.prefix ?: "${meta.id}"
+ def output_file = bam_format ? "${prefix}.bam" : "${prefix}.paf"
+ """
+ touch $output_file
+
cat <<-END_VERSIONS > versions.yml
"${task.process}":
minimap2: \$(minimap2 --version 2>&1)
diff --git a/modules/nf-core/minimap2/align/meta.yml b/modules/nf-core/minimap2/align/meta.yml
index 991b39a0..408522d5 100644
--- a/modules/nf-core/minimap2/align/meta.yml
+++ b/modules/nf-core/minimap2/align/meta.yml
@@ -25,6 +25,11 @@ input:
description: |
List of input FASTA or FASTQ files of size 1 and 2 for single-end
and paired-end data, respectively.
+ - meta2:
+ type: map
+ description: |
+ Groovy Map containing reference information
+ e.g. [ id:'test_ref']
- reference:
type: file
description: |
@@ -63,3 +68,8 @@ authors:
- "@sofstam"
- "@sateeshperi"
- "@jfy133"
+maintainers:
+ - "@heuermh"
+ - "@sofstam"
+ - "@sateeshperi"
+ - "@jfy133"
diff --git a/modules/nf-core/minimap2/align/tests/main.nf.test b/modules/nf-core/minimap2/align/tests/main.nf.test
new file mode 100644
index 00000000..4d77e0d9
--- /dev/null
+++ b/modules/nf-core/minimap2/align/tests/main.nf.test
@@ -0,0 +1,179 @@
+nextflow_process {
+
+ name "Test Process MINIMAP2_ALIGN"
+ script "../main.nf"
+ process "MINIMAP2_ALIGN"
+
+ tag "modules"
+ tag "modules_nfcore"
+ tag "minimap2"
+ tag "minimap2/align"
+
+ test("sarscov2 - fastq, fasta, true, false, false") {
+
+ when {
+ process {
+ """
+ input[0] = [
+ [ id:'test', single_end:true ], // meta map
+ file(params.test_data['sarscov2']['illumina']['test_1_fastq_gz'], checkIfExists: true)
+ ]
+ input[1] = [
+ [ id:'test_ref' ], // meta map
+ file(params.test_data['sarscov2']['genome']['genome_fasta'], checkIfExists: true)
+ ]
+ input[2] = true
+ input[3] = false
+ input[4] = false
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(
+ file(process.out.bam[0][1]).name,
+ process.out.versions
+ ).match() }
+ )
+ }
+
+ }
+
+ test("sarscov2 - [fastq1, fastq2], fasta, true, false, false") {
+
+ when {
+ process {
+ """
+ input[0] = [
+ [ id:'test', single_end:false ], // meta map
+ [
+ file(params.test_data['sarscov2']['illumina']['test_1_fastq_gz'], checkIfExists: true),
+ file(params.test_data['sarscov2']['illumina']['test_2_fastq_gz'], checkIfExists: true)
+ ]
+ ]
+ input[1] = [
+ [ id:'test_ref' ], // meta map
+ file(params.test_data['sarscov2']['genome']['genome_fasta'], checkIfExists: true)
+ ]
+ input[2] = true
+ input[3] = false
+ input[4] = false
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(
+ file(process.out.bam[0][1]).name,
+ process.out.versions
+ ).match() }
+ )
+ }
+
+ }
+
+ test("sarscov2 - fastq, [], true, false, false") {
+
+ when {
+ process {
+ """
+ input[0] = [
+ [ id:'test', single_end:true ], // meta map
+ file(params.test_data['sarscov2']['illumina']['test_1_fastq_gz'], checkIfExists: true)
+ ]
+ input[1] = [
+ [ id:'test_ref' ], // meta map
+ []
+ ]
+ input[2] = true
+ input[3] = false
+ input[4] = false
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(
+ file(process.out.bam[0][1]).name,
+ process.out.versions
+ ).match() }
+ )
+ }
+
+ }
+
+ test("sarscov2 - fastq, fasta, true, false, false - stub") {
+
+ options "-stub"
+
+ when {
+ process {
+ """
+ input[0] = [
+ [ id:'test', single_end:true ], // meta map
+ file(params.test_data['sarscov2']['illumina']['test_1_fastq_gz'], checkIfExists: true)
+ ]
+ input[1] = [
+ [ id:'test_ref' ], // meta map
+ file(params.test_data['sarscov2']['genome']['genome_fasta'], checkIfExists: true)
+ ]
+ input[2] = true
+ input[3] = false
+ input[4] = false
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(
+ file(process.out.bam[0][1]).name,
+ process.out.versions
+ ).match() }
+ )
+ }
+
+ }
+
+ test("sarscov2 - fastq, fasta, false, false, false - stub") {
+
+ options "-stub"
+
+ when {
+ process {
+ """
+ input[0] = [
+ [ id:'test', single_end:true ], // meta map
+ file(params.test_data['sarscov2']['illumina']['test_1_fastq_gz'], checkIfExists: true)
+ ]
+ input[1] = [
+ [ id:'test_ref' ], // meta map
+ file(params.test_data['sarscov2']['genome']['genome_fasta'], checkIfExists: true)
+ ]
+ input[2] = false
+ input[3] = false
+ input[4] = false
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(
+ file(process.out.paf[0][1]).name,
+ process.out.versions
+ ).match() }
+ )
+ }
+
+ }
+
+}
diff --git a/modules/nf-core/minimap2/align/tests/main.nf.test.snap b/modules/nf-core/minimap2/align/tests/main.nf.test.snap
new file mode 100644
index 00000000..ec99d13e
--- /dev/null
+++ b/modules/nf-core/minimap2/align/tests/main.nf.test.snap
@@ -0,0 +1,67 @@
+{
+ "sarscov2 - fastq, fasta, true, false, false": {
+ "content": [
+ "test.bam",
+ [
+ "versions.yml:md5,9e9eeae0002d466d580a9d6e0d003eb1"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.0"
+ },
+ "timestamp": "2023-12-04T12:07:06.01315354"
+ },
+ "sarscov2 - fastq, fasta, true, false, false - stub": {
+ "content": [
+ "test.bam",
+ [
+ "versions.yml:md5,9e9eeae0002d466d580a9d6e0d003eb1"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.0"
+ },
+ "timestamp": "2023-12-04T12:07:24.487175659"
+ },
+ "sarscov2 - fastq, fasta, false, false, false - stub": {
+ "content": [
+ "test.paf",
+ [
+ "versions.yml:md5,9e9eeae0002d466d580a9d6e0d003eb1"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.0"
+ },
+ "timestamp": "2024-03-01T11:06:54.090105"
+ },
+ "sarscov2 - [fastq1, fastq2], fasta, true, false, false": {
+ "content": [
+ "test.bam",
+ [
+ "versions.yml:md5,9e9eeae0002d466d580a9d6e0d003eb1"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.0"
+ },
+ "timestamp": "2023-12-04T12:07:12.50816279"
+ },
+ "sarscov2 - fastq, [], true, false, false": {
+ "content": [
+ "test.bam",
+ [
+ "versions.yml:md5,9e9eeae0002d466d580a9d6e0d003eb1"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.0"
+ },
+ "timestamp": "2023-12-04T12:07:18.414974788"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/minimap2/align/tests/tags.yml b/modules/nf-core/minimap2/align/tests/tags.yml
new file mode 100644
index 00000000..39dba374
--- /dev/null
+++ b/modules/nf-core/minimap2/align/tests/tags.yml
@@ -0,0 +1,2 @@
+minimap2/align:
+ - "modules/nf-core/minimap2/align/**"
diff --git a/modules/nf-core/nanoplot/main.nf b/modules/nf-core/nanoplot/main.nf
index c011ae72..1124dfa7 100644
--- a/modules/nf-core/nanoplot/main.nf
+++ b/modules/nf-core/nanoplot/main.nf
@@ -32,6 +32,26 @@ process NANOPLOT {
mv NanoStats.txt ${prefix}.txt
+ cat <<-END_VERSIONS > versions.yml
+ "${task.process}":
+ nanoplot: \$(echo \$(NanoPlot --version 2>&1) | sed 's/^.*NanoPlot //; s/ .*\$//')
+ END_VERSIONS
+ """
+
+ stub:
+ """
+ touch LengthvsQualityScatterPlot_dot.html
+ touch LengthvsQualityScatterPlot_kde.html
+ touch NanoPlot-report.html
+ touch NanoPlot_20240301_1130.log
+ touch NanoStats.txt
+ touch Non_weightedHistogramReadlength.html
+ touch Non_weightedLogTransformed_HistogramReadlength.html
+ touch WeightedHistogramReadlength.html
+ touch WeightedLogTransformed_HistogramReadlength.html
+ touch Yield_By_Length.html
+
+
cat <<-END_VERSIONS > versions.yml
"${task.process}":
nanoplot: \$(echo \$(NanoPlot --version 2>&1) | sed 's/^.*NanoPlot //; s/ .*\$//')
diff --git a/modules/nf-core/nanoplot/tests/main.nf.test b/modules/nf-core/nanoplot/tests/main.nf.test
index d8dc6bc0..29b57c10 100644
--- a/modules/nf-core/nanoplot/tests/main.nf.test
+++ b/modules/nf-core/nanoplot/tests/main.nf.test
@@ -32,7 +32,7 @@ nextflow_process {
with(process.out.html.get(0)) {
assert get(1).collect { p -> file(p).getName() }.contains("NanoPlot-report.html")
}
- }
+ }
)
}
@@ -63,7 +63,30 @@ nextflow_process {
with(process.out.html.get(0)) {
assert get(1).collect { p -> file(p).getName() }.contains("NanoPlot-report.html")
}
- }
+ }
+ )
+ }
+
+ }
+
+ test("NanoPlot - stub") {
+
+ options "-stub"
+ when {
+ process {
+ """
+ input[0] = [
+ [ id:'test' ], // meta map
+ [ file(params.test_data['sarscov2']['nanopore']['test_sequencing_summary'], checkIfExists: true) ]
+ ]
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(process.out).match() }
)
}
diff --git a/modules/nf-core/nanoplot/tests/main.nf.test.snap b/modules/nf-core/nanoplot/tests/main.nf.test.snap
index 1df28066..f7f8028a 100644
--- a/modules/nf-core/nanoplot/tests/main.nf.test.snap
+++ b/modules/nf-core/nanoplot/tests/main.nf.test.snap
@@ -1,4 +1,93 @@
{
+ "NanoPlot - stub": {
+ "content": [
+ {
+ "0": [
+ [
+ {
+ "id": "test"
+ },
+ [
+ "LengthvsQualityScatterPlot_dot.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "LengthvsQualityScatterPlot_kde.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "NanoPlot-report.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "Non_weightedHistogramReadlength.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "Non_weightedLogTransformed_HistogramReadlength.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "WeightedHistogramReadlength.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "WeightedLogTransformed_HistogramReadlength.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "Yield_By_Length.html:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ]
+ ],
+ "1": [
+
+ ],
+ "2": [
+ [
+ {
+ "id": "test"
+ },
+ "NanoStats.txt:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "3": [
+ [
+ {
+ "id": "test"
+ },
+ "NanoPlot_20240301_1130.log:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "4": [
+ "versions.yml:md5,961cee64736aeb9e56b65d05ee3cd1a5"
+ ],
+ "html": [
+ [
+ {
+ "id": "test"
+ },
+ [
+ "LengthvsQualityScatterPlot_dot.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "LengthvsQualityScatterPlot_kde.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "NanoPlot-report.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "Non_weightedHistogramReadlength.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "Non_weightedLogTransformed_HistogramReadlength.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "WeightedHistogramReadlength.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "WeightedLogTransformed_HistogramReadlength.html:md5,d41d8cd98f00b204e9800998ecf8427e",
+ "Yield_By_Length.html:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ]
+ ],
+ "log": [
+ [
+ {
+ "id": "test"
+ },
+ "NanoPlot_20240301_1130.log:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "png": [
+
+ ],
+ "txt": [
+ [
+ {
+ "id": "test"
+ },
+ "NanoStats.txt:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "versions": [
+ "versions.yml:md5,961cee64736aeb9e56b65d05ee3cd1a5"
+ ]
+ }
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.0"
+ },
+ "timestamp": "2024-03-01T14:54:18.083198"
+ },
"NanoPlot FASTQ": {
"content": [
[
@@ -13,6 +102,10 @@
"versions.yml:md5,961cee64736aeb9e56b65d05ee3cd1a5"
]
],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.0"
+ },
"timestamp": "2023-10-17T16:18:44.848688965"
},
"NanoPlot summary": {
@@ -29,6 +122,10 @@
"versions.yml:md5,961cee64736aeb9e56b65d05ee3cd1a5"
]
],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.0"
+ },
"timestamp": "2023-10-17T16:18:31.104601192"
}
}
\ No newline at end of file
diff --git a/modules/nf-core/porechop/porechop/environment.yml b/modules/nf-core/porechop/porechop/environment.yml
new file mode 100644
index 00000000..28b67c16
--- /dev/null
+++ b/modules/nf-core/porechop/porechop/environment.yml
@@ -0,0 +1,7 @@
+name: porechop_porechop
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::porechop=0.2.4
diff --git a/modules/nf-core/porechop/porechop/main.nf b/modules/nf-core/porechop/porechop/main.nf
index 8fe0dd2e..1ff02a12 100644
--- a/modules/nf-core/porechop/porechop/main.nf
+++ b/modules/nf-core/porechop/porechop/main.nf
@@ -2,7 +2,7 @@ process PORECHOP_PORECHOP {
tag "$meta.id"
label 'process_medium'
- conda "bioconda::porechop=0.2.4"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/porechop:0.2.4--py39h7cff6ad_2' :
'biocontainers/porechop:0.2.4--py39h7cff6ad_2' }"
@@ -33,4 +33,16 @@ process PORECHOP_PORECHOP {
porechop: \$( porechop --version )
END_VERSIONS
"""
+
+ stub:
+ def prefix = task.ext.prefix ?: "${meta.id}"
+ """
+ touch ${prefix}.fastq
+ gzip ${prefix}.fastq
+ touch ${prefix}.log
+ cat <<-END_VERSIONS > versions.yml
+ "${task.process}":
+ porechop: \$( porechop --version )
+ END_VERSIONS
+ """
}
diff --git a/modules/nf-core/porechop/porechop/meta.yml b/modules/nf-core/porechop/porechop/meta.yml
index 98b838f6..13be76f2 100644
--- a/modules/nf-core/porechop/porechop/meta.yml
+++ b/modules/nf-core/porechop/porechop/meta.yml
@@ -12,7 +12,6 @@ tools:
tool_dev_url: "https://github.com/rrwick/Porechop"
doi: "10.1099/mgen.0.000132"
licence: ["GPL v3"]
-
input:
- meta:
type: map
@@ -23,7 +22,6 @@ input:
type: file
description: fastq/fastq.gz file
pattern: "*.{fastq,fastq.gz,fq,fq.gz}"
-
output:
- meta:
type: map
@@ -42,7 +40,6 @@ output:
type: file
description: Log file containing stdout information
pattern: "*.log"
-
authors:
- "@ggabernet"
- "@jasmezz"
@@ -53,3 +50,13 @@ authors:
- "@jonoave"
- "@GokceOGUZ"
- "@jfy133"
+maintainers:
+ - "@ggabernet"
+ - "@jasmezz"
+ - "@d4straub"
+ - "@LaurenceKuhl"
+ - "@SusiJo"
+ - "@jonasscheid"
+ - "@jonoave"
+ - "@GokceOGUZ"
+ - "@jfy133"
diff --git a/modules/nf-core/porechop/porechop/tests/main.nf.test b/modules/nf-core/porechop/porechop/tests/main.nf.test
new file mode 100644
index 00000000..4c3c3d65
--- /dev/null
+++ b/modules/nf-core/porechop/porechop/tests/main.nf.test
@@ -0,0 +1,61 @@
+nextflow_process {
+
+ name "Test Process PORECHOP_PORECHOP"
+ script "../main.nf"
+ process "PORECHOP_PORECHOP"
+ config "./nextflow.config"
+
+ tag "modules"
+ tag "modules_nfcore"
+ tag "porechop"
+ tag "porechop/porechop"
+
+ test("sarscov2 - nanopore - fastq") {
+
+ when {
+ process {
+ """
+ input[0] = [ [ id:'test', single_end:true ],
+ file(params.test_data['sarscov2']['nanopore']['test_fastq_gz'], checkIfExists: true)
+ ]
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(process.out.reads).match("reads") },
+ { assert snapshot(process.out.versions).match("versions") },
+ // complete log is not stable. These first lines should be stable
+ { assert snapshot(path(process.out.log.get(0).get(1)).readLines()[0..7]).match("log")}
+ )
+ }
+
+ }
+
+
+ test("stub") {
+ options "-stub"
+
+ when {
+ process {
+ """
+ input[0] = [ [ id:'test', single_end:true ],
+ []
+ ]
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(process.out).match() }
+ )
+ }
+
+ }
+
+
+}
diff --git a/modules/nf-core/porechop/porechop/tests/main.nf.test.snap b/modules/nf-core/porechop/porechop/tests/main.nf.test.snap
new file mode 100644
index 00000000..cf544d2d
--- /dev/null
+++ b/modules/nf-core/porechop/porechop/tests/main.nf.test.snap
@@ -0,0 +1,88 @@
+{
+ "versions": {
+ "content": [
+ [
+ "versions.yml:md5,712c0753b56d0fb530092dfb5bdf2e5c"
+ ]
+ ],
+ "timestamp": "2023-12-18T07:47:16.83444"
+ },
+ "log": {
+ "content": [
+ [
+ "",
+ "\u001b[1m\u001b[4mLoading reads\u001b[0m",
+ "test.fastq.gz",
+ "100 reads loaded",
+ "",
+ "",
+ "\u001b[1m\u001b[4mLooking for known adapter sets\u001b[0m",
+ ""
+ ]
+ ],
+ "timestamp": "2023-12-18T07:47:16.853899"
+ },
+ "reads": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": true
+ },
+ "test_porechop.fastq.gz:md5,886fdb859fb50e0dddd35007bcff043e"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-18T07:47:16.811393"
+ },
+ "stub": {
+ "content": [
+ {
+ "0": [
+ [
+ {
+ "id": "test",
+ "single_end": true
+ },
+ "test_porechop.fastq.gz:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "1": [
+ [
+ {
+ "id": "test",
+ "single_end": true
+ },
+ "test_porechop.log:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "2": [
+ "versions.yml:md5,712c0753b56d0fb530092dfb5bdf2e5c"
+ ],
+ "log": [
+ [
+ {
+ "id": "test",
+ "single_end": true
+ },
+ "test_porechop.log:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "reads": [
+ [
+ {
+ "id": "test",
+ "single_end": true
+ },
+ "test_porechop.fastq.gz:md5,d41d8cd98f00b204e9800998ecf8427e"
+ ]
+ ],
+ "versions": [
+ "versions.yml:md5,712c0753b56d0fb530092dfb5bdf2e5c"
+ ]
+ }
+ ],
+ "timestamp": "2023-12-18T07:47:37.814949"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/porechop/porechop/tests/nextflow.config b/modules/nf-core/porechop/porechop/tests/nextflow.config
new file mode 100644
index 00000000..a9ecf7b6
--- /dev/null
+++ b/modules/nf-core/porechop/porechop/tests/nextflow.config
@@ -0,0 +1,9 @@
+process {
+
+
+ withName: PORECHOP_PORECHOP {
+ ext.args = ''
+ ext.prefix = { "${meta.id}_porechop" }
+ }
+
+}
diff --git a/modules/nf-core/porechop/porechop/tests/tags.yml b/modules/nf-core/porechop/porechop/tests/tags.yml
new file mode 100644
index 00000000..743645c2
--- /dev/null
+++ b/modules/nf-core/porechop/porechop/tests/tags.yml
@@ -0,0 +1,2 @@
+porechop/porechop:
+ - "modules/nf-core/porechop/porechop/**"
diff --git a/modules/nf-core/prokka/environment.yml b/modules/nf-core/prokka/environment.yml
new file mode 100644
index 00000000..d7c44d5a
--- /dev/null
+++ b/modules/nf-core/prokka/environment.yml
@@ -0,0 +1,7 @@
+name: prokka
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::prokka=1.14.6
diff --git a/modules/nf-core/prokka/main.nf b/modules/nf-core/prokka/main.nf
index 60fbe232..adfda037 100644
--- a/modules/nf-core/prokka/main.nf
+++ b/modules/nf-core/prokka/main.nf
@@ -2,9 +2,9 @@ process PROKKA {
tag "$meta.id"
label 'process_low'
- conda "bioconda::prokka=1.14.6"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
- 'https://depot.galaxyproject.org/singularity/prokka%3A1.14.6--pl5321hdfd78af_4' :
+ 'https://depot.galaxyproject.org/singularity/prokka:1.14.6--pl5321hdfd78af_4' :
'biocontainers/prokka:1.14.6--pl5321hdfd78af_4' }"
input:
diff --git a/modules/nf-core/prokka/meta.yml b/modules/nf-core/prokka/meta.yml
index 7fc9e185..9d82ffac 100644
--- a/modules/nf-core/prokka/meta.yml
+++ b/modules/nf-core/prokka/meta.yml
@@ -10,7 +10,6 @@ tools:
homepage: https://github.com/tseemann/prokka
doi: "10.1093/bioinformatics/btu153"
licence: ["GPL v2"]
-
input:
- meta:
type: map
@@ -27,7 +26,6 @@ input:
- prodigal_tf:
type: file
description: Training file to use for Prodigal (optional)
-
output:
- meta:
type: map
@@ -86,6 +84,7 @@ output:
type: file
description: tab-separated file of all features (locus_tag,ftype,len_bp,gene,EC_number,COG,product)
pattern: "*.{tsv}"
-
authors:
- "@rpetit3"
+maintainers:
+ - "@rpetit3"
diff --git a/modules/nf-core/prokka/tests/main.nf.test b/modules/nf-core/prokka/tests/main.nf.test
new file mode 100644
index 00000000..3b59ef3a
--- /dev/null
+++ b/modules/nf-core/prokka/tests/main.nf.test
@@ -0,0 +1,46 @@
+nextflow_process {
+
+ name "Test Process PROKKA"
+ script "../main.nf"
+ process "PROKKA"
+
+ tag "modules"
+ tag "modules_nfcore"
+ tag "prokka"
+
+ test("Prokka - sarscov2 - genome.fasta") {
+
+ when {
+ process {
+ """
+ input[0] = Channel.fromList([
+ tuple([ id:'test', single_end:false ], // meta map
+ file(params.test_data['sarscov2']['genome']['genome_fasta'], checkIfExists: true))
+ ])
+ input[1] = []
+ input[2] = []
+ """
+ }
+ }
+
+ then {
+ assertAll(
+ { assert process.success },
+ { assert snapshot(process.out.gff).match("gff") },
+ { assert snapshot(process.out.fna).match("fna") },
+ { assert snapshot(process.out.faa).match("faa") },
+ { assert snapshot(process.out.ffn).match("ffn") },
+ { assert snapshot(process.out.fsa).match("fsa") },
+ { assert snapshot(process.out.tbl).match("tbl") },
+ { assert snapshot(process.out.err).match("err") },
+ { assert snapshot(process.out.txt).match("txt") },
+ { assert snapshot(process.out.tsv).match("tsv") },
+ { assert path(process.out.gbk.get(0).get(1)).exists() },
+ { assert path(process.out.log.get(0).get(1)).exists() },
+ { assert path(process.out.sqn.get(0).get(1)).exists() }
+ )
+ }
+
+ }
+
+}
diff --git a/modules/nf-core/prokka/tests/main.nf.test.snap b/modules/nf-core/prokka/tests/main.nf.test.snap
new file mode 100644
index 00000000..859e8df8
--- /dev/null
+++ b/modules/nf-core/prokka/tests/main.nf.test.snap
@@ -0,0 +1,128 @@
+{
+ "txt": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.txt:md5,b40e485ffc8eaf1feacf8d79d9751a33"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-14T15:19:54.84139118"
+ },
+ "err": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.err:md5,b3daedc646fddd422824e2b3e5e9229d"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-14T15:19:54.837204155"
+ },
+ "fsa": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.fsa:md5,71bbefcb7f12046bcd3263f58cfd5404"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-14T15:19:54.803513721"
+ },
+ "gff": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.gff:md5,5dbfb8fcf2db020564c16045976a0933"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-14T15:19:54.710100529"
+ },
+ "tsv": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.tsv:md5,da7c720c3018c5081d6a70b517b7d450"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-14T15:19:54.846026731"
+ },
+ "faa": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.faa:md5,a4ceda83262b3c222a6b1f508fb9e24b"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-14T15:19:54.722112433"
+ },
+ "fna": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.fna:md5,787307f29a263e5657cc276ebbf7e2b3"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-14T15:19:54.717325796"
+ },
+ "ffn": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.ffn:md5,80f474b5367b7ea5ed23791935f65e34"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-14T15:19:54.727149899"
+ },
+ "tbl": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.tbl:md5,d8f816a066ced94b62d9618b13fb8add"
+ ]
+ ]
+ ],
+ "timestamp": "2023-12-14T15:19:54.831206944"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/prokka/tests/tags.yml b/modules/nf-core/prokka/tests/tags.yml
new file mode 100644
index 00000000..a2dc7bdc
--- /dev/null
+++ b/modules/nf-core/prokka/tests/tags.yml
@@ -0,0 +1,2 @@
+prokka:
+ - "modules/nf-core/prokka/**"
diff --git a/modules/nf-core/quast/environment.yml b/modules/nf-core/quast/environment.yml
new file mode 100644
index 00000000..0f9e3079
--- /dev/null
+++ b/modules/nf-core/quast/environment.yml
@@ -0,0 +1,7 @@
+name: quast
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::quast=5.2.0
diff --git a/modules/nf-core/quast/main.nf b/modules/nf-core/quast/main.nf
index e265df73..d8f36284 100644
--- a/modules/nf-core/quast/main.nf
+++ b/modules/nf-core/quast/main.nf
@@ -2,7 +2,7 @@ process QUAST {
tag "$meta.id"
label 'process_medium'
- conda "bioconda::quast=5.2.0"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/quast:5.2.0--py39pl5321h2add14b_1' :
'biocontainers/quast:5.2.0--py39pl5321h2add14b_1' }"
diff --git a/modules/nf-core/quast/meta.yml b/modules/nf-core/quast/meta.yml
index 78e94f8e..5850ff98 100644
--- a/modules/nf-core/quast/meta.yml
+++ b/modules/nf-core/quast/meta.yml
@@ -25,7 +25,6 @@ input:
- gff:
type: file
description: The genome GFF file. Has to contain at least a non-empty string dummy value.
-
output:
- quast:
type: directory
@@ -54,7 +53,9 @@ output:
type: file
description: File containing software versions
pattern: "versions.yml"
-
authors:
- "@drpatelh"
- "@kevinmenden"
+maintainers:
+ - "@drpatelh"
+ - "@kevinmenden"
diff --git a/modules/nf-core/racon/environment.yml b/modules/nf-core/racon/environment.yml
new file mode 100644
index 00000000..abc5d784
--- /dev/null
+++ b/modules/nf-core/racon/environment.yml
@@ -0,0 +1,7 @@
+name: racon
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::racon=1.4.20
diff --git a/modules/nf-core/racon/main.nf b/modules/nf-core/racon/main.nf
index 6d0cceb2..de29e355 100644
--- a/modules/nf-core/racon/main.nf
+++ b/modules/nf-core/racon/main.nf
@@ -2,7 +2,7 @@ process RACON {
tag "$meta.id"
label 'process_high'
- conda "bioconda::racon=1.4.20"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/racon:1.4.20--h9a82719_1' :
'biocontainers/racon:1.4.20--h9a82719_1' }"
diff --git a/modules/nf-core/racon/meta.yml b/modules/nf-core/racon/meta.yml
index 2e7737d9..9698c0a8 100644
--- a/modules/nf-core/racon/meta.yml
+++ b/modules/nf-core/racon/meta.yml
@@ -13,7 +13,6 @@ tools:
tool_dev_url: https://github.com/lbcb-sci/racon
doi: 10.1101/gr.214270.116
licence: ["MIT"]
-
input:
- meta:
type: map
@@ -32,7 +31,6 @@ input:
type: file
description: Alignment in PAF format
pattern: "*.paf"
-
output:
- meta:
type: map
@@ -47,6 +45,7 @@ output:
type: file
description: Improved genome assembly
pattern: "*_assembly_consensus.fasta.gz"
-
authors:
- "@avantonder"
+maintainers:
+ - "@avantonder"
diff --git a/modules/nf-core/samtools/index/environment.yml b/modules/nf-core/samtools/index/environment.yml
new file mode 100644
index 00000000..a5e50649
--- /dev/null
+++ b/modules/nf-core/samtools/index/environment.yml
@@ -0,0 +1,8 @@
+name: samtools_index
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::samtools=1.19.2
+ - bioconda::htslib=1.19.1
diff --git a/modules/nf-core/samtools/index/main.nf b/modules/nf-core/samtools/index/main.nf
index 0b20aa4b..dc14f98d 100644
--- a/modules/nf-core/samtools/index/main.nf
+++ b/modules/nf-core/samtools/index/main.nf
@@ -2,10 +2,10 @@ process SAMTOOLS_INDEX {
tag "$meta.id"
label 'process_low'
- conda "bioconda::samtools=1.17"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
- 'https://depot.galaxyproject.org/singularity/samtools:1.17--h00cdaf9_0' :
- 'biocontainers/samtools:1.17--h00cdaf9_0' }"
+ 'https://depot.galaxyproject.org/singularity/samtools:1.19.2--h50ea8bc_0' :
+ 'biocontainers/samtools:1.19.2--h50ea8bc_0' }"
input:
tuple val(meta), path(input)
diff --git a/modules/nf-core/samtools/index/meta.yml b/modules/nf-core/samtools/index/meta.yml
index 8bd2fa6f..01a4ee03 100644
--- a/modules/nf-core/samtools/index/meta.yml
+++ b/modules/nf-core/samtools/index/meta.yml
@@ -51,3 +51,7 @@ authors:
- "@drpatelh"
- "@ewels"
- "@maxulysse"
+maintainers:
+ - "@drpatelh"
+ - "@ewels"
+ - "@maxulysse"
diff --git a/modules/nf-core/samtools/index/tests/csi.nextflow.config b/modules/nf-core/samtools/index/tests/csi.nextflow.config
new file mode 100644
index 00000000..0ed260ef
--- /dev/null
+++ b/modules/nf-core/samtools/index/tests/csi.nextflow.config
@@ -0,0 +1,7 @@
+process {
+
+ withName: SAMTOOLS_INDEX {
+ ext.args = '-c'
+ }
+
+}
diff --git a/modules/nf-core/samtools/index/tests/main.nf.test b/modules/nf-core/samtools/index/tests/main.nf.test
new file mode 100644
index 00000000..bb7756d1
--- /dev/null
+++ b/modules/nf-core/samtools/index/tests/main.nf.test
@@ -0,0 +1,87 @@
+nextflow_process {
+
+ name "Test Process SAMTOOLS_INDEX"
+ script "../main.nf"
+ process "SAMTOOLS_INDEX"
+ tag "modules"
+ tag "modules_nfcore"
+ tag "samtools"
+ tag "samtools/index"
+
+ test("bai") {
+
+ when {
+ params {
+ outdir = "$outputDir"
+ }
+ process {
+ """
+ input[0] = Channel.of([
+ [ id:'test', single_end:false ], // meta map
+ file(params.modules_testdata_base_path + 'genomics/sarscov2/illumina/bam/test.paired_end.sorted.bam', checkIfExists: true)
+ ])
+ """
+ }
+ }
+
+ then {
+ assertAll (
+ { assert process.success },
+ { assert snapshot(process.out.bai).match("bai") },
+ { assert snapshot(process.out.versions).match("bai_versions") }
+ )
+ }
+ }
+
+ test("crai") {
+
+ when {
+ params {
+ outdir = "$outputDir"
+ }
+ process {
+ """
+ input[0] = Channel.of([
+ [ id:'test', single_end:false ], // meta map
+ file(params.modules_testdata_base_path + 'genomics/homo_sapiens/illumina/cram/test.paired_end.recalibrated.sorted.cram', checkIfExists: true)
+ ])
+ """
+ }
+ }
+
+ then {
+ assertAll (
+ { assert process.success },
+ { assert snapshot(process.out.crai).match("crai") },
+ { assert snapshot(process.out.versions).match("crai_versions") }
+ )
+ }
+ }
+
+ test("csi") {
+
+ config "./csi.nextflow.config"
+
+ when {
+ params {
+ outdir = "$outputDir"
+ }
+ process {
+ """
+ input[0] = Channel.of([
+ [ id:'test', single_end:false ], // meta map
+ file(params.modules_testdata_base_path + 'genomics/sarscov2/illumina/bam/test.paired_end.sorted.bam', checkIfExists: true)
+ ])
+ """
+ }
+ }
+
+ then {
+ assertAll (
+ { assert process.success },
+ { assert path(process.out.csi.get(0).get(1)).exists() },
+ { assert snapshot(process.out.versions).match("csi_versions") }
+ )
+ }
+ }
+}
diff --git a/modules/nf-core/samtools/index/tests/main.nf.test.snap b/modules/nf-core/samtools/index/tests/main.nf.test.snap
new file mode 100644
index 00000000..3dc8e7de
--- /dev/null
+++ b/modules/nf-core/samtools/index/tests/main.nf.test.snap
@@ -0,0 +1,74 @@
+{
+ "crai_versions": {
+ "content": [
+ [
+ "versions.yml:md5,cc4370091670b64bba7c7206403ffb3e"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "24.01.0"
+ },
+ "timestamp": "2024-02-13T16:12:00.324667957"
+ },
+ "csi_versions": {
+ "content": [
+ [
+ "versions.yml:md5,cc4370091670b64bba7c7206403ffb3e"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "24.01.0"
+ },
+ "timestamp": "2024-02-13T16:12:07.885103162"
+ },
+ "crai": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.paired_end.recalibrated.sorted.cram.crai:md5,14bc3bd5c89cacc8f4541f9062429029"
+ ]
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.04.3"
+ },
+ "timestamp": "2024-02-12T18:41:38.446424"
+ },
+ "bai": {
+ "content": [
+ [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.paired_end.sorted.bam.bai:md5,704c10dd1326482448ca3073fdebc2f4"
+ ]
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.04.3"
+ },
+ "timestamp": "2024-02-12T18:40:46.579747"
+ },
+ "bai_versions": {
+ "content": [
+ [
+ "versions.yml:md5,cc4370091670b64bba7c7206403ffb3e"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "24.01.0"
+ },
+ "timestamp": "2024-02-13T16:11:51.641425452"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/samtools/index/tests/tags.yml b/modules/nf-core/samtools/index/tests/tags.yml
new file mode 100644
index 00000000..e0f58a7a
--- /dev/null
+++ b/modules/nf-core/samtools/index/tests/tags.yml
@@ -0,0 +1,2 @@
+samtools/index:
+ - modules/nf-core/samtools/index/**
diff --git a/modules/nf-core/samtools/sort/environment.yml b/modules/nf-core/samtools/sort/environment.yml
new file mode 100644
index 00000000..4d898e48
--- /dev/null
+++ b/modules/nf-core/samtools/sort/environment.yml
@@ -0,0 +1,8 @@
+name: samtools_sort
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+dependencies:
+ - bioconda::samtools=1.19.2
+ - bioconda::htslib=1.19.1
diff --git a/modules/nf-core/samtools/sort/main.nf b/modules/nf-core/samtools/sort/main.nf
index 2b7753fd..fc374f98 100644
--- a/modules/nf-core/samtools/sort/main.nf
+++ b/modules/nf-core/samtools/sort/main.nf
@@ -2,17 +2,20 @@ process SAMTOOLS_SORT {
tag "$meta.id"
label 'process_medium'
- conda "bioconda::samtools=1.17"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
- 'https://depot.galaxyproject.org/singularity/samtools:1.17--h00cdaf9_0' :
- 'biocontainers/samtools:1.17--h00cdaf9_0' }"
+ 'https://depot.galaxyproject.org/singularity/samtools:1.19.2--h50ea8bc_0' :
+ 'biocontainers/samtools:1.19.2--h50ea8bc_0' }"
input:
- tuple val(meta), path(bam)
+ tuple val(meta) , path(bam)
+ tuple val(meta2), path(fasta)
output:
- tuple val(meta), path("*.bam"), emit: bam
- tuple val(meta), path("*.csi"), emit: csi, optional: true
+ tuple val(meta), path("*.bam"), emit: bam, optional: true
+ tuple val(meta), path("*.cram"), emit: cram, optional: true
+ tuple val(meta), path("*.crai"), emit: crai, optional: true
+ tuple val(meta), path("*.csi"), emit: csi, optional: true
path "versions.yml" , emit: versions
when:
@@ -21,14 +24,24 @@ process SAMTOOLS_SORT {
script:
def args = task.ext.args ?: ''
def prefix = task.ext.prefix ?: "${meta.id}"
+ def extension = args.contains("--output-fmt sam") ? "sam" :
+ args.contains("--output-fmt cram") ? "cram" :
+ "bam"
+ def reference = fasta ? "--reference ${fasta}" : ""
if ("$bam" == "${prefix}.bam") error "Input and output names are the same, use \"task.ext.prefix\" to disambiguate!"
+
"""
+ samtools cat \\
+ --threads $task.cpus \\
+ ${bam} \\
+ | \\
samtools sort \\
$args \\
- -@ $task.cpus \\
- -o ${prefix}.bam \\
- -T $prefix \\
- $bam
+ -T ${prefix} \\
+ --threads $task.cpus \\
+ ${reference} \\
+ -o ${prefix}.${extension} \\
+ -
cat <<-END_VERSIONS > versions.yml
"${task.process}":
@@ -40,6 +53,7 @@ process SAMTOOLS_SORT {
def prefix = task.ext.prefix ?: "${meta.id}"
"""
touch ${prefix}.bam
+ touch ${prefix}.bam.csi
cat <<-END_VERSIONS > versions.yml
"${task.process}":
diff --git a/modules/nf-core/samtools/sort/meta.yml b/modules/nf-core/samtools/sort/meta.yml
index 07328431..341a7d0e 100644
--- a/modules/nf-core/samtools/sort/meta.yml
+++ b/modules/nf-core/samtools/sort/meta.yml
@@ -23,8 +23,18 @@ input:
e.g. [ id:'test', single_end:false ]
- bam:
type: file
- description: BAM/CRAM/SAM file
+ description: BAM/CRAM/SAM file(s)
pattern: "*.{bam,cram,sam}"
+ - meta2:
+ type: map
+ description: |
+ Groovy Map containing reference information
+ e.g. [ id:'genome' ]
+ - fasta:
+ type: file
+ description: Reference genome FASTA file
+ pattern: "*.{fa,fasta,fna}"
+ optional: true
output:
- meta:
type: map
@@ -33,16 +43,29 @@ output:
e.g. [ id:'test', single_end:false ]
- bam:
type: file
- description: Sorted BAM/CRAM/SAM file
- pattern: "*.{bam,cram,sam}"
- - versions:
+ description: Sorted BAM file
+ pattern: "*.{bam}"
+ - cram:
type: file
- description: File containing software versions
- pattern: "versions.yml"
+ description: Sorted CRAM file
+ pattern: "*.{cram}"
+ - crai:
+ type: file
+ description: CRAM index file (optional)
+ pattern: "*.crai"
- csi:
type: file
description: BAM index file (optional)
pattern: "*.csi"
+ - versions:
+ type: file
+ description: File containing software versions
+ pattern: "versions.yml"
authors:
- "@drpatelh"
- "@ewels"
+ - "@matthdsm"
+maintainers:
+ - "@drpatelh"
+ - "@ewels"
+ - "@matthdsm"
diff --git a/modules/nf-core/samtools/sort/tests/main.nf.test b/modules/nf-core/samtools/sort/tests/main.nf.test
new file mode 100644
index 00000000..8360e2b1
--- /dev/null
+++ b/modules/nf-core/samtools/sort/tests/main.nf.test
@@ -0,0 +1,96 @@
+nextflow_process {
+
+ name "Test Process SAMTOOLS_SORT"
+ script "../main.nf"
+ process "SAMTOOLS_SORT"
+ tag "modules"
+ tag "modules_nfcore"
+ tag "samtools"
+ tag "samtools/sort"
+
+ test("bam") {
+
+ config "./nextflow.config"
+
+ when {
+ process {
+ """
+ input[0] = Channel.of([
+ [ id:'test', single_end:false ], // meta map
+ file(params.modules_testdata_base_path + 'genomics/sarscov2/illumina/bam/test.paired_end.bam', checkIfExists: true)
+ ])
+ input[1] = Channel.of([
+ [ id:'fasta' ], // meta map
+ file(params.modules_testdata_base_path + 'genomics/sarscov2/genome/genome.fasta', checkIfExists: true)
+ ])
+ """
+ }
+ }
+
+ then {
+ assertAll (
+ { assert process.success },
+ { assert snapshot(process.out).match() }
+ )
+ }
+ }
+
+ test("cram") {
+
+ config "./nextflow.config"
+
+ when {
+ process {
+ """
+ input[0] = Channel.of([
+ [ id:'test', single_end:false ], // meta map
+ file(params.modules_testdata_base_path + 'genomics/sarscov2/illumina/bam/test.paired_end.bam', checkIfExists: true)
+ ])
+ input[1] = Channel.of([
+ [ id:'fasta' ], // meta map
+ file(params.modules_testdata_base_path + 'genomics/sarscov2/genome/genome.fasta', checkIfExists: true)
+ ])
+ """
+ }
+ }
+
+ then {
+ assertAll (
+ { assert process.success },
+ { assert snapshot(process.out).match() }
+ )
+ }
+ }
+
+ test("bam_stub") {
+
+ config "./nextflow.config"
+ options "-stub"
+
+ when {
+ params {
+ outdir = "$outputDir"
+ }
+ process {
+ """
+ input[0] = Channel.of([
+ [ id:'test', single_end:false ], // meta map
+ file(params.modules_testdata_base_path + 'genomics/sarscov2/illumina/bam/test.paired_end.bam', checkIfExists: true)
+ ])
+ input[1] = Channel.of([
+ [ id:'fasta' ], // meta map
+ file(params.modules_testdata_base_path + 'genomics/sarscov2/genome/genome.fasta', checkIfExists: true)
+ ])
+ """
+ }
+ }
+
+ then {
+ assertAll (
+ { assert process.success },
+ { assert snapshot(file(process.out.bam[0][1]).name).match("bam_stub_bam") },
+ { assert snapshot(process.out.versions).match("bam_stub_versions") }
+ )
+ }
+ }
+}
diff --git a/modules/nf-core/samtools/sort/tests/main.nf.test.snap b/modules/nf-core/samtools/sort/tests/main.nf.test.snap
new file mode 100644
index 00000000..38477656
--- /dev/null
+++ b/modules/nf-core/samtools/sort/tests/main.nf.test.snap
@@ -0,0 +1,154 @@
+{
+ "cram": {
+ "content": [
+ {
+ "0": [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.sorted.bam:md5,bc0b7c25da26384a006ed84cc9e4da23"
+ ]
+ ],
+ "1": [
+
+ ],
+ "2": [
+
+ ],
+ "3": [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.sorted.bam.csi:md5,8d4e836c2fed6c0bf874d5e8cdba5831"
+ ]
+ ],
+ "4": [
+ "versions.yml:md5,e6d43fefc9a8bff91c2ce6e3a1716eca"
+ ],
+ "bam": [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.sorted.bam:md5,bc0b7c25da26384a006ed84cc9e4da23"
+ ]
+ ],
+ "crai": [
+
+ ],
+ "cram": [
+
+ ],
+ "csi": [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.sorted.bam.csi:md5,8d4e836c2fed6c0bf874d5e8cdba5831"
+ ]
+ ],
+ "versions": [
+ "versions.yml:md5,e6d43fefc9a8bff91c2ce6e3a1716eca"
+ ]
+ }
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.1"
+ },
+ "timestamp": "2024-03-04T15:08:00.830294"
+ },
+ "bam_stub_bam": {
+ "content": [
+ "test.sorted.bam"
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.04.3"
+ },
+ "timestamp": "2024-02-12T19:21:04.364044"
+ },
+ "bam_stub_versions": {
+ "content": [
+ [
+ "versions.yml:md5,e6d43fefc9a8bff91c2ce6e3a1716eca"
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "24.01.0"
+ },
+ "timestamp": "2024-02-13T16:15:00.20800281"
+ },
+ "bam": {
+ "content": [
+ {
+ "0": [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.sorted.bam:md5,bc0b7c25da26384a006ed84cc9e4da23"
+ ]
+ ],
+ "1": [
+
+ ],
+ "2": [
+
+ ],
+ "3": [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.sorted.bam.csi:md5,8d4e836c2fed6c0bf874d5e8cdba5831"
+ ]
+ ],
+ "4": [
+ "versions.yml:md5,e6d43fefc9a8bff91c2ce6e3a1716eca"
+ ],
+ "bam": [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.sorted.bam:md5,bc0b7c25da26384a006ed84cc9e4da23"
+ ]
+ ],
+ "crai": [
+
+ ],
+ "cram": [
+
+ ],
+ "csi": [
+ [
+ {
+ "id": "test",
+ "single_end": false
+ },
+ "test.sorted.bam.csi:md5,8d4e836c2fed6c0bf874d5e8cdba5831"
+ ]
+ ],
+ "versions": [
+ "versions.yml:md5,e6d43fefc9a8bff91c2ce6e3a1716eca"
+ ]
+ }
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.1"
+ },
+ "timestamp": "2024-03-04T15:07:48.773803"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/samtools/sort/tests/nextflow.config b/modules/nf-core/samtools/sort/tests/nextflow.config
new file mode 100644
index 00000000..f642771f
--- /dev/null
+++ b/modules/nf-core/samtools/sort/tests/nextflow.config
@@ -0,0 +1,8 @@
+process {
+
+ withName: SAMTOOLS_SORT {
+ ext.prefix = { "${meta.id}.sorted" }
+ ext.args = "--write-index"
+ }
+
+}
diff --git a/modules/nf-core/samtools/sort/tests/tags.yml b/modules/nf-core/samtools/sort/tests/tags.yml
new file mode 100644
index 00000000..cd63ea20
--- /dev/null
+++ b/modules/nf-core/samtools/sort/tests/tags.yml
@@ -0,0 +1,3 @@
+samtools/sort:
+ - modules/nf-core/samtools/sort/**
+ - tests/modules/nf-core/samtools/sort/**
diff --git a/modules/nf-core/untar/environment.yml b/modules/nf-core/untar/environment.yml
new file mode 100644
index 00000000..0c9cbb10
--- /dev/null
+++ b/modules/nf-core/untar/environment.yml
@@ -0,0 +1,11 @@
+name: untar
+
+channels:
+ - conda-forge
+ - bioconda
+ - defaults
+
+dependencies:
+ - conda-forge::grep=3.11
+ - conda-forge::sed=4.7
+ - conda-forge::tar=1.34
diff --git a/modules/nf-core/untar/main.nf b/modules/nf-core/untar/main.nf
index 61461c39..8a75bb95 100644
--- a/modules/nf-core/untar/main.nf
+++ b/modules/nf-core/untar/main.nf
@@ -2,7 +2,7 @@ process UNTAR {
tag "$archive"
label 'process_single'
- conda "conda-forge::sed=4.7 conda-forge::grep=3.11 conda-forge::tar=1.34"
+ conda "${moduleDir}/environment.yml"
container "${ workflow.containerEngine == 'singularity' && !task.ext.singularity_pull_docker_container ?
'https://depot.galaxyproject.org/singularity/ubuntu:20.04' :
'nf-core/ubuntu:20.04' }"
diff --git a/modules/nf-core/untar/meta.yml b/modules/nf-core/untar/meta.yml
index db241a6e..a9a2110f 100644
--- a/modules/nf-core/untar/meta.yml
+++ b/modules/nf-core/untar/meta.yml
@@ -39,3 +39,8 @@ authors:
- "@drpatelh"
- "@matthdsm"
- "@jfy133"
+maintainers:
+ - "@joseespinosa"
+ - "@drpatelh"
+ - "@matthdsm"
+ - "@jfy133"
diff --git a/modules/nf-core/untar/tests/main.nf.test b/modules/nf-core/untar/tests/main.nf.test
new file mode 100644
index 00000000..2a7c97bf
--- /dev/null
+++ b/modules/nf-core/untar/tests/main.nf.test
@@ -0,0 +1,47 @@
+nextflow_process {
+
+ name "Test Process UNTAR"
+ script "../main.nf"
+ process "UNTAR"
+ tag "modules"
+ tag "modules_nfcore"
+ tag "untar"
+ test("test_untar") {
+
+ when {
+ process {
+ """
+ input[0] = [ [], file(params.modules_testdata_base_path + 'genomics/sarscov2/genome/db/kraken2.tar.gz', checkIfExists: true) ]
+ """
+ }
+ }
+
+ then {
+ assertAll (
+ { assert process.success },
+ { assert snapshot(process.out.untar).match("test_untar") },
+ )
+ }
+
+ }
+
+ test("test_untar_onlyfiles") {
+
+ when {
+ process {
+ """
+ input[0] = [ [], file(params.modules_testdata_base_path + 'generic/tar/hello.tar.gz', checkIfExists: true) ]
+ """
+ }
+ }
+
+ then {
+ assertAll (
+ { assert process.success },
+ { assert snapshot(process.out.untar).match("test_untar_onlyfiles") },
+ )
+ }
+
+ }
+
+}
diff --git a/modules/nf-core/untar/tests/main.nf.test.snap b/modules/nf-core/untar/tests/main.nf.test.snap
new file mode 100644
index 00000000..64550292
--- /dev/null
+++ b/modules/nf-core/untar/tests/main.nf.test.snap
@@ -0,0 +1,42 @@
+{
+ "test_untar_onlyfiles": {
+ "content": [
+ [
+ [
+ [
+
+ ],
+ [
+ "hello.txt:md5,e59ff97941044f85df5297e1c302d260"
+ ]
+ ]
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.1"
+ },
+ "timestamp": "2024-02-28T11:49:41.320643"
+ },
+ "test_untar": {
+ "content": [
+ [
+ [
+ [
+
+ ],
+ [
+ "hash.k2d:md5,8b8598468f54a7087c203ad0190555d9",
+ "opts.k2d:md5,a033d00cf6759407010b21700938f543",
+ "taxo.k2d:md5,094d5891cdccf2f1468088855c214b2c"
+ ]
+ ]
+ ]
+ ],
+ "meta": {
+ "nf-test": "0.8.4",
+ "nextflow": "23.10.1"
+ },
+ "timestamp": "2024-02-28T11:49:33.795172"
+ }
+}
\ No newline at end of file
diff --git a/modules/nf-core/untar/tests/tags.yml b/modules/nf-core/untar/tests/tags.yml
new file mode 100644
index 00000000..feb6f15c
--- /dev/null
+++ b/modules/nf-core/untar/tests/tags.yml
@@ -0,0 +1,2 @@
+untar:
+ - modules/nf-core/untar/**
diff --git a/subworkflows/local/utils_nfcore_bacass_pipeline/main.nf b/subworkflows/local/utils_nfcore_bacass_pipeline/main.nf
index 0b617a34..e02fe978 100644
--- a/subworkflows/local/utils_nfcore_bacass_pipeline/main.nf
+++ b/subworkflows/local/utils_nfcore_bacass_pipeline/main.nf
@@ -197,7 +197,6 @@ def genomeExistsError() {
// Generate methods description for MultiQC
//
def toolCitationText() {
- // TODO nf-core: Optionally add in-text citation tools to this list.
// Can use ternary operators to dynamically construct based conditions, e.g. params["run_xyz"] ? "Tool (Foo et al. 2023)" : "",
// Uncomment function in methodsDescriptionText to render in MultiQC report
def citation_text = [
@@ -226,7 +225,6 @@ def toolCitationText() {
}
def toolBibliographyText() {
- // TODO nf-core: Optionally add bibliographic entries to this list.
// Can use ternary operators to dynamically construct based conditions, e.g. params["run_xyz"] ? "Author (2023) Pub name, Journal, DOI" : "",
// Uncomment function in methodsDescriptionText to render in MultiQC report
def reference_text = [
diff --git a/workflows/bacass.nf b/workflows/bacass.nf
index a38fc0d6..ca644cc5 100644
--- a/workflows/bacass.nf
+++ b/workflows/bacass.nf
@@ -26,12 +26,12 @@ if(! params.skip_kraken2){
//
// MODULE: Local to the pipeline
//
-include { PYCOQC } from '../modules/local/pycoqc'
-include { UNICYCLER } from '../modules/local/unicycler'
-include { NANOPOLISH } from '../modules/local/nanopolish'
-include { MEDAKA } from '../modules/local/medaka'
-include { KRAKEN2_DB_PREPARATION } from '../modules/local/kraken2_db_preparation'
-include { DFAST } from '../modules/local/dfast'
+include { PYCOQC } from '../modules/local/pycoqc/main'
+include { UNICYCLER } from '../modules/local/unicycler/main'
+include { NANOPOLISH } from '../modules/local/nanopolish/main'
+include { MEDAKA } from '../modules/local/medaka/main'
+include { KRAKEN2_DB_PREPARATION } from '../modules/local/kraken2_db_preparation/main'
+include { DFAST } from '../modules/local/dfast/main'
//
// SUBWORKFLOW: Consisting of a mix of local and nf-core/modules
@@ -240,7 +240,7 @@ workflow BACASS {
if ( params.assembler == 'miniasm' ) {
MINIMAP2_ALIGN (
ch_for_assembly.map{ meta,sr,lr -> tuple(meta,lr) },
- [],
+ [[:],[]],
false,
false,
false
@@ -259,7 +259,7 @@ workflow BACASS {
MINIMAP2_CONSENSUS (
ch_for_assembly.map{ meta,sr,lr -> tuple(meta,lr) },
- MINIASM.out.assembly.map { meta, assembly -> assembly },
+ MINIASM.out.assembly,
false,
false,
false
@@ -347,6 +347,7 @@ workflow BACASS {
KRAKEN2_DB_PREPARATION (
kraken2db
)
+ ch_versions = ch_versions.mix(KRAKEN2_DB_PREPARATION.out.versions)
KRAKEN2 (
ch_for_kraken2_short.dump(tag: 'kraken2_short'),
KRAKEN2_DB_PREPARATION.out.db.map { info, db -> db }.dump(tag: 'kraken2_db_preparation'),
|